SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Capca1|186523|fgenesh1_pg.C_scaffold_160000030 from Capitella sp. I

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Capca1|186523|fgenesh1_pg.C_scaffold_160000030
Domain Number - Region: 87-144
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.08
Family Tetracyclin repressor-like, C-terminal domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Capca1|186523|fgenesh1_pg.C_scaffold_160000030
Sequence length 605
Sequence
MDPASAEPVSPSHCIFGRRNWVAWSPESVDAKVTSLLDNFWQWRLDKSPEFATRVGLGGR
DHLLEEYSEESFFEQKIKADEFLKQTEYLQNFENITHDDNINLEVLKYVLQTYIDGYQHR
RFTVYNPNNFLQDWKRLIGFMKFNTEADYDNLIARYRLIPKQINEHISLMRKAIEFETTR
HRLSMEKDNLYKDLLDEIEISAGESLFFNPFKKIPLEIPLRRRLKLRQRGEAAIDEWVKP
AWKRLYSFLITEYVPNARQNVGLSSMPGGFECYESILRWHTTTSLSPQEVHDIGLREVQR
LQDLMMRMVVEDGFQEMSLREYVDHLNSQEDNFFTSGAEMVLGYQAIVENIRKKLPSALH
RVPQTAMETRGFSSDVGPQGYYIDPALDGTRPGTFFANVYMPRTKPKFDMYALTLHEAEP
GHHTQAAYALEENLPQFRRTIEFRKYYAVPFNWPFMTAYIEGWALYAEYLGESMGVYEDR
RALWSPRKAEAYLQKYTTLSEKAITSEVLRYITLPGQACAYKIGEIKIVELREKAELMLG
ENFDQRDFHHEILRLGAVPLGVLEDSISYWIQNWTPSSSVSDKSPAGAMPTAFIIGMLVT
LFLLW
Download sequence
Identical sequences R7V2X2
jgi|Capca1|186523|fgenesh1_pg.C_scaffold_160000030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]