SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Capca1|202391|fgenesh1_pg.C_scaffold_40273000001 from Capitella sp. I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Capca1|202391|fgenesh1_pg.C_scaffold_40273000001
Domain Number 1 Region: 5-102
Classification Level Classification E-value
Superfamily L,D-transpeptidase catalytic domain-like 6.8e-21
Family L,D-transpeptidase catalytic domain-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Capca1|202391|fgenesh1_pg.C_scaffold_40273000001
Sequence length 120
Sequence
MAFSGVATVGKLAEWPDWVPTADIQARLGPYPKRVPGGPANPLGARAIYLYEGNKDTLYR
IHGTNQPEYIGQAISSGCIRMTNTDVADLYNRVQMGSTVVVLPPGQSVASTNANIFARRS
Download sequence
Identical sequences jgi|Capca1|202391|fgenesh1_pg.C_scaffold_40273000001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]