SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Capca1|207208|fgenesh1_pg.C_scaffold_84000038 from Capitella sp. I

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Capca1|207208|fgenesh1_pg.C_scaffold_84000038
Domain Number - Region: 522-568
Classification Level Classification E-value
Superfamily BRCA2 helical domain 0.0183
Family BRCA2 helical domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Capca1|207208|fgenesh1_pg.C_scaffold_84000038
Sequence length 572
Sequence
MGEHRGRNSGILWRNSDADASLSDEAFADLGDSNPSWLSSLLFEHGIEPLEIDQERKRNS
PSNGHSAFEEESDMDALEESLVSGQPVIERSVNVTPSQNVHSPLSVSLKQEFLPPRPIPF
PWKTPQTGHKNNSLVARLGLNISESGTSWTDSLATPNNDVSKSSLSRQTSNKSTEDTLET
TKKTDLEECENLLQDLPENAFSQEYLIPESDAHKSIAKQGAEESSAKLKEVYANPHDYAE
LDCDAVGFLNSSWEADIPQNWNTQWEQEVIEGDCGSPLTADCPNHDQKINTETENYSIIH
EGNEKILYDELQEKDLPHKEKGFGGFQTASGKNVTVSEEALVKARQSMDDLPHEVTGFGG
FQTASGKDVTVSDEALVKARQSMDDLLHEEKGFGGFQTASGNSVTVSEEAPVIPKQRTEG
LNNPSSSFPRSQTENSSPLMITNVCLDEDYPSDRCGSFAPLQCTLNVTGSPSEAAATESI
DLDAFFEADFSQMEQHNTPHFKISQQVVKDRLKAQVRQTQRISAKRKRQDIQPRPGSLWR
QRRSRKRISLKEEFCGERPRRQSRNQVLFLNF
Download sequence
Identical sequences R7T6W0
jgi|Capca1|207208|fgenesh1_pg.C_scaffold_84000038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]