SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Capca1|220406|estExt_fgenesh1_pg.C_150015 from Capitella sp. I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Capca1|220406|estExt_fgenesh1_pg.C_150015
Domain Number 1 Region: 454-705
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.55e-25
Family RecA protein-like (ATPase-domain) 0.068
Further Details:      
 
Domain Number 2 Region: 312-418
Classification Level Classification E-value
Superfamily DNA primase core 0.000000000863
Family Primase fragment of primase-helicase protein 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Capca1|220406|estExt_fgenesh1_pg.C_150015
Sequence length 730
Sequence
MYLAESVRVDEGACIAPSIRLAHGSIHIYLNYAKLIESDGKAINMVEGLILWKTTLARAP
RFETMATMKCSPLWRAMASSMISTSSSKHRGLSTSITKCASWSQNKHNRLLIKTQLRSMT
SNSSGNAEEYEPVNAKVIKAYLQQSSLQFKEGHTCVVTTCPRLNHTKLRLNNVNKMYINS
VTGYFTCLKCHKSGTWDHFKTNANNLISLMVKRKRIPGECLSMIEETEDIELSKTAAIFN
DAGPIKNLTDEDAYDLKHRLGIHNLSMETLNTFRIRVINSDQGYSLLVPLYDLRDAIVGM
KIHTVTKFTVQEMQRNRVVSKIIPKLEFGSLFGWHLMKPKHKSVVLTASEWDAMAIYQVT
GVPALALPRGSAFLSQKVLPALEQFSSITLWLDSDVKSWEAAKILSKKLNESRCSLVKPA
ENQPSPLTALKEGYNISSILKAARPIKHQSITSFRSLRQEVFSTLSESDVVAGVKWKRYP
HLNKLLKGHRRGELTVFTGPTGSGKTTFISDYSLDLAMQGVNTLWGSFEINNVKLMKTML
TQFAQMNLVKNIDLFDETADAFESLPLFFMTFHGQEDTKKVIETMSHAVYIHDIQHVIVD
NLQFMMGSSSFHRSSTDRFLIQDEIISAFRRFATHMNCHVTLVIHPRKEKDSEDLSMSSI
FGSAKATQEADNVLILQDKRLVSPRGKKYIQVAKNRFDGELGVMLLKYDKDSLSFSGISK
PVTTSQEADQ
Download sequence
Identical sequences R7V4A8
jgi|Capca1|220406|estExt_fgenesh1_pg.C_150015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]