SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Capca1|222963|estExt_fgenesh1_pg.C_30088 from Capitella sp. I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Capca1|222963|estExt_fgenesh1_pg.C_30088
Domain Number 1 Region: 35-285
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 3.58e-63
Family PdxS-like 0.0000000527
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Capca1|222963|estExt_fgenesh1_pg.C_30088
Sequence length 316
Sequence
MPQLPGVNSNGASAKDGAQTTGSFTLKSGLAQMAKGGLVMDVTDAQQARIAEEAGACAVM
ALERVPADIRRDGGVARMSDPKMIKEIMAAVTIPVMAKARIGHFAEAQILQALGVDMIDE
SEVLTPADPEAHIDKSQFKIPFVCGARNLGEALRRIHEGAAMIRTKGEAGTGNVLEAVRH
AKTINADIMAAKKMDDTQLAVYAKELRVPVELLKKTVDMGRLPVVNFAAGGLATPADVSL
MMQLGVDGVFVGSGIFKSNCPKKRADSMVQAVTHYKDPAFLAEISEDLGEAMVGINCDDI
KQKWAVRESHPQQKKA
Download sequence
Identical sequences X2ATT4
jgi|Capca1|222963|estExt_fgenesh1_pg.C_30088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]