SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Capca1|206171|fgenesh1_pg.C_scaffold_7336000001 from Capitella sp. I

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Capca1|206171|fgenesh1_pg.C_scaffold_7336000001
Domain Number 1 Region: 3-197
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 1.53e-34
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Capca1|206171|fgenesh1_pg.C_scaffold_7336000001
Sequence length 197
Sequence
MGGASEEHSSLHLRTTAQFEVISKCEMVLRLTDVTMEDSNPSNLETRQQVQRSNEFKQAL
ETRTLRFSFVDGHVQSICADQEEPVWVLNIKRGILSAFQNTMETLDEDQRVFETDVAGTC
PTEYESKGKSWTTRTVMKTKDLIGCIDRSGPQSAFQGAPFQVPSDIQTLPVMKSTHECEQ
QINSAGILTQSVCKETH
Download sequence
Identical sequences R7TIB2
jgi|Capca1|206171|fgenesh1_pg.C_scaffold_7336000001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]