SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000003089 from Microcebus murinus 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMICP00000003089
Domain Number - Region: 60-146
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 0.091
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000003089   Gene: ENSMICG00000003401   Transcript: ENSMICT00000003397
Sequence length 252
Comment pep:novel genescaffold:micMur1:GeneScaffold_2359:606750:607508:-1 gene:ENSMICG00000003401 transcript:ENSMICT00000003397 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSKQLFCDGKEVVHATEGLDWEDKDAPGTLVGNVVHSRIISPLRLFVKQSPVPKPGPMAY
AADTMDSFWDWLANITEVQEPLTRTKRRPIVKTGKFKKMFGWGDFHSNIKTVKLNLLITG
KIVDHGNGTFSVYFRHNSTGLGNVSVSLVPPSKVVEFEVSPQSTLETKESKSFNCRIEYE
KTDRAKKTALCNFDPSKICYQEQTQSHVSWLCSKPFKVICIYIAFYSVDYKLVQKVCPDY
NYHSETPYLSSG
Download sequence
Identical sequences ENSMICP00000003089 ENSMICP00000003089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]