SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000003670 from Microcebus murinus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000003670
Domain Number 1 Region: 135-226
Classification Level Classification E-value
Superfamily TAFH domain-like 1.11e-35
Family TAFH domain-like 0.0000034
Further Details:      
 
Domain Number 2 Region: 419-466
Classification Level Classification E-value
Superfamily Histone-fold 2.18e-17
Family TBP-associated factors, TAFs 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000003670   Gene: ENSMICG00000004029   Transcript: ENSMICT00000004026
Sequence length 632
Comment pep:novel genescaffold:micMur1:GeneScaffold_1754:5180:35478:-1 gene:ENSMICG00000004029 transcript:ENSMICT00000004026 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLVRSENGQLLMIPQQALAQMQAQAHAQAQPQTTMAPRPATPTSAPPVQISTVQAPGTP
IIARQVTPTTIIKQVSQAQTTVPPPTTLQRSPGVQXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXETMENVKKCKNFLSTLIKLASSGKQSTETAANVKELVQNLLDGKM
EAEDFTSRLYRELNSSPQPYLVPFLKRSLPALRQLTPDSAAFIQQSQQQPPPTSQATTAL
TAVVLSGSVQRTAGKTAATVTSALQPPVLSLAQPTQVGVGKQGQPTPLVIQQPPKPGALI
RPPQVTLTQTPMVALRQPHSRIMLTTPPQIQLNPLQPVPVVKPAVLPGTKALSAVSAQAA
AAQKSKLKEPGGGSFRDDDDINDVASMAGVNLSEESARILATNSELVGTLTRSCKDETFL
LPAPLQRRILEIGKKHGITELHPDVVSYVSHATQQRLQNLVEKISETAQQKNFSYKXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGSGPGSVVPGGSGVGTPRQFARQ
RITRVNLRDLIFCLENERETSHSLLLYKAFLK
Download sequence
Identical sequences ENSMICP00000003670 ENSMICP00000003670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]