SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000006944 from Microcebus murinus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000006944
Domain Number 1 Region: 175-434
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.37e-58
Family Eukaryotic proteases 0.00064
Further Details:      
 
Domain Number 2 Region: 57-168
Classification Level Classification E-value
Superfamily Kringle-like 2.1e-31
Family Kringle modules 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000006944   Gene: ENSMICG00000007634   Transcript: ENSMICT00000007631
Sequence length 443
Comment pep:novel genescaffold:micMur1:GeneScaffold_2909:129081:134594:1 gene:ENSMICG00000007634 transcript:ENSMICT00000007631 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RYEYLEWDRWARVHQGRVEWCSCGCQAWCEGTRHTACLSSPCLNGGTCHLIVATGTTVCA
CPPGFAGRLCNIVPAERCFLGNGTGYRGVATTSASGLGCLAWNSDLLYQELHVDSVGVAA
LLGLGPHAYCRNPDKDERPWCYEVKDNALSWEYCHLAACESLARIQPLLPEVLVTLPEPA
PAGRQTCGKRHKKRTFLRPRIIGGSSSLPGSHPWLIYINNFCSGLVHTCWGXXXXXXXXX
XXPQRESVKVVLGQHFFNRTTDVTQTFGIEKYIPYPLYSVFSPSDHDLVLIRLKKKGDRC
AVRSQFVQPICLPEPGSTFPAGHKCQIAGWGHMDENVSGYASSREAVPLVADHKCSSPEV
YGADINPNMLCAGYFDCKSDACQGDSGGPLACEKNGMAYLYGIISWGDGCGRLNKPGVYT
RVANYVDWLNDRMRTPKRPTAPS
Download sequence
Identical sequences ENSMICP00000006944 ENSMICP00000006944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]