SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000008327 from Microcebus murinus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000008327
Domain Number 1 Region: 147-242
Classification Level Classification E-value
Superfamily S13-like H2TH domain 2.22e-23
Family Middle domain of MutM-like DNA repair proteins 0.014
Further Details:      
 
Domain Number 2 Region: 33-123
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 0.0000000183
Family N-terminal domain of MutM-like DNA repair proteins 0.011
Further Details:      
 
Domain Number 3 Region: 310-337
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000044
Family Ran binding protein zinc finger-like 0.0043
Further Details:      
 
Weak hits

Sequence:  ENSMICP00000008327
Domain Number - Region: 234-274
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00998
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000008327   Gene: ENSMICG00000009147   Transcript: ENSMICT00000009144
Sequence length 538
Comment pep:novel scaffold:micMur1:scaffold_832:158385:199524:1 gene:ENSMICG00000009147 transcript:ENSMICT00000009144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVEGPGCTLNGEKIRARVLPGQAVTGVRGSALPSLEGRALPHAAASSQAAALNKDANQNF
LKLFDGYVYSGVETLGKELFMYFGQKAFRIHFGMKGSVMINPLGYERNGVSPVLEIQLTK
DLICFFDSSVTNSMESQQRIRMMEELDICSPKFSFSRAESEVKKQRGRMLCDVLMDQRVL
PGVGNIIKNEALFDSGLHPAVKVCQLTDEQTHHLVKMIRDFSILFYRCRKAGSAISKHYK
VYKRPNCGQCHCKITVCRFGENNRMTYFCPHCQKENPRHVDICKLPTRNTIISWTSSRVD
HLMDTVARKSEEQWTCGVCTLINKPSSKSCDACLTARPVDSMLKNEENPIAFNNLVKYPC
NSFGKPDTEVKINRKTAFGTTTLVLTDFSNKSSTLERKKSQNQILDGEFPNPPPPHVCFS
DTQHPSKERTNYITQLSSKVNTSPTVCSESKLFSPAHKKLKTTHYSSPDLKSCNPGFSKS
ELQINMADGPCAFNTGSPRCSKHNRLCTFRVVRKDGENKGRQFYACPLPREAQCGFFE
Download sequence
Identical sequences ENSMICP00000008327 ENSMICP00000008327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]