SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000009406 from Microcebus murinus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000009406
Domain Number 1 Region: 8-71
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 2.49e-24
Family Transcriptional factor domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000009406   Gene: ENSMICG00000010333   Transcript: ENSMICT00000010327
Sequence length 71
Comment pep:novel genescaffold:micMur1:GeneScaffold_2968:24443:26835:-1 gene:ENSMICG00000010333 transcript:ENSMICT00000010327 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTNRKYPKLKEVDDVLGGAAAWENVDSTAEPCPKCEHPRAYFMQLQTRSADEPMTTFYKC
CNAQCGHRWRD
Download sequence
Identical sequences A0A212CYH3 L8J2H4
ENSMICP00000009406 ENSMICP00000009406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]