SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000010876 from Microcebus murinus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000010876
Domain Number 1 Region: 1-132
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.46e-36
Family G proteins 0.0000428
Further Details:      
 
Domain Number 2 Region: 141-178
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000144
Family SOCS box-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000010876   Gene: ENSMICG00000011951   Transcript: ENSMICT00000011946
Sequence length 228
Comment pep:novel genescaffold:micMur1:GeneScaffold_2254:45056:56664:-1 gene:ENSMICG00000011951 transcript:ENSMICT00000011946 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IDYKTTTILLDGRRVKLQLWDTSGQGRFCTIFRSYSRGAQGVILVYDIANRWSFDGINRW
IKEIDEHAPGVPKILVGNRLHLAFKRQVPTEQAQAYAERLGVTFFEVSPLCNFNVTESFT
ELARTVLLRHGMDRLRRPSKVLSLQDLCCRAVVSCTPAHLVDTLPLPPALRSHLKSFCMA
NGLSARMTPGRAYSLAATHKRNSFRKGKGARPPQSPPKNCSRNSCKIS
Download sequence
Identical sequences ENSMICP00000010876 ENSMICP00000010876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]