SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000011891 from Microcebus murinus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000011891
Domain Number 1 Region: 109-245
Classification Level Classification E-value
Superfamily dUTPase-like 2.22e-48
Family dUTPase-like 0.000000142
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000011891   Gene: ENSMICG00000013050   Transcript: ENSMICT00000013045
Sequence length 250
Comment pep:novel genescaffold:micMur1:GeneScaffold_401:132142:142491:1 gene:ENSMICG00000013050 transcript:ENSMICT00000013045 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPRCPRSALCYHFLPSLLRSVFKNAPGARQGAEAAGLFWPGRALGPAALLRTLRTASSA
SRQSRACRGASKVGAGWQGALSEAWGCPPPSPTTVVSPSKRARPAEEGGMQLRFARLSEH
ATAPTRGSARAAGYDLYSAYDYTIPSMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFI
DVGAGVIDEDYRGNVGVVLFNFGKENFEVKKGDRIAQLICERIFYPEIEEVQVLDDTERG
SGGFGSTGKN
Download sequence
Identical sequences ENSMICP00000011891 ENSMICP00000011891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]