SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000012347 from Microcebus murinus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000012347
Domain Number 1 Region: 210-284
Classification Level Classification E-value
Superfamily GAS2 domain-like 6.93e-27
Family GAS2 domain 0.0000419
Further Details:      
 
Domain Number 2 Region: 36-164
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.28e-25
Family Calponin-homology domain, CH-domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000012347   Gene: ENSMICG00000013533   Transcript: ENSMICT00000013534
Sequence length 681
Comment pep:novel genescaffold:micMur1:GeneScaffold_94:124108:138003:1 gene:ENSMICG00000013533 transcript:ENSMICT00000013534 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VWFGEDLPLSPRSPLTPRHGPGLANVCQYDEWITVRHAATLLPMQEDLSIWLSGLLGIEV
KAEKLLEELDNGVLLCQLIKVLQNMVKTCNSEEPENFPMGKVPCKKDAASGSFFARDNTA
NFLHWCRHIGVDETFLFESEGLVLHKDPRQVYLCLLEIGRIVSXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVKHIAEDPPCSCSHRFSIEYLSEGRYRLGD
KVLFIRMLHGKHVMVRVGGGWDTLQGFLLKYDPCRILQFATLEQKILAFQKGVSNESAPD
LPARTPQPPEMNPLSAVNMFQKQNSKPGTPVGFPRGKEKQARQPGTLPPSSSPKRGNLGS
VSVRSKFPNALAASSHPKLKPSKGITKKPHAPSNSVASSNPVGKNTSSPAFSRTVPCASE
SLRKCMASPSIPKAKVIPAKNSRDLPDSTLLPSKCSGKTEPKYLKHNHISPRDGAAFHLA
AHLNSSKCPKLPEANIHTRPKPSPSSQSSAKMTKPSSRTIATGPGTRSQPSHRAPQGKPI
PAQKLKSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSSKSTSQKPSSVRTKSENKKPT
AKKKEDDDHYFVMTGSKKPRK
Download sequence
Identical sequences ENSMICP00000012347 ENSMICP00000012347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]