SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000013923 from Microcebus murinus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000013923
Domain Number 1 Region: 21-277
Classification Level Classification E-value
Superfamily Carbonic anhydrase 2.75e-89
Family Carbonic anhydrase 0.000000000611
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000013923   Gene: ENSMICG00000015268   Transcript: ENSMICT00000015263
Sequence length 336
Comment pep:novel genescaffold:micMur1:GeneScaffold_138:121330:127048:1 gene:ENSMICG00000015268 transcript:ENSMICT00000015263 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLFFALLLEVIWILAADGGQHWTYEGPHGQDHWPASYPECGSNAQSPIDIQTDSVTFDPE
LPALQPHGYDQPGTEPLDLHNNGHTVQLSLPPTLYLGGLPQKYVAAQLHLHWGEKGSPGG
SEHQINSEATAAELHIVHYDSDSYDSLSEAAQRPQGLAVLGILIEVGETKNIAYEHILSH
LHEIRHKDQKTSVPPFNVRELLPTELGQFFRYNGSLTTPPCYQSVLWTVFSQRAQISMGQ
LEKLQETLFSTEEPSKLLVQNYRAPQPLNQRTVFASFIQVGSLYTTXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXKKRLENRKSVVFTSARATTEA
Download sequence
Identical sequences ENSMICP00000013923 ENSMICP00000013923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]