SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMICP00000015515 from Microcebus murinus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMICP00000015515
Domain Number 1 Region: 1-121
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.48e-28
Family G proteins 0.0002
Further Details:      
 
Domain Number 2 Region: 121-160
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000000497
Family SOCS box-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMICP00000015515   Gene: ENSMICG00000017032   Transcript: ENSMICT00000017027
Sequence length 213
Comment pep:novel genescaffold:micMur1:GeneScaffold_857:115096:122205:1 gene:ENSMICG00000017032 transcript:ENSMICT00000017027 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DTSGQGRFCTIFRSYSRGAQGILLVYDITNRWSFDGIDRWIKEIDEHAPGVPRILVGNRL
HLAFKRQVPTEQARAYAEKNCMTFFEVSPLCNFNVIESFTELSRIVLMRHGMEKIWRPNR
VFSLQDLCCRAIVSCTPVHLIDKLPLPVTIKSHLKSFSMANGMNAVMMHGRSYSLASGAG
GGSSKGNSLKRSKSIRPPQSPPQNCSRSNCKIS
Download sequence
Identical sequences ENSMICP00000015515 ENSMICP00000015515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]