SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CIHT_01674 from Coccidioides immitis H538.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CIHT_01674
Domain Number 1 Region: 49-206
Classification Level Classification E-value
Superfamily E set domains 0.0000000161
Family Arrestin/Vps26-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CIHT_01674
Sequence length 785
Comment | CIHG_01666 | Coccidioides immitis H538.4 pH-response regulator protein palF/RIM8 (786 aa)
Sequence
MALDSPNGDATSASPARKRSILSKFTNRFGNRNRNISEFYIQPDDPWRSYSPGDIVDGSV
CLVVVKPVRITHLVVCLHGYAKVYKNPVAPGETAEDSGFPGTGRGRRNGEYLGNGLATLF
EDEIVLCGDGRLKEGIYKFRFELCFPPYSLPSSINFERGTISYVITSTLTRPTTISPTIS
CDKRILLLETIDIANLPPPKPRVISLEPISKRSKTRSKTKSTSSEMPRRASSLEPQSSDS
GPPLSPVPSERSNSSCVSNSTQSFQIVSEPSSARCGAQRNDDLWSGATSSASQEITATTK
VLRAGVLPGDLLPVNISIKHTKPIRSPNGVIITLYRQGRIDMYPQLPIGTPEKGKKPVYE
DYYPKSRTGLGGLSFGVTRTSSVFRKDLSQIFCPLIVDPNTMTAEIKTSIRIPENAFPTI
TRVPGAMISFRYYVEVVMDIRGKLAGQDRFLPRLNMMSNNFYGNGKMNTAAEIQRGMTTS
NVAGNILDTEQVRRDKSVIIAPVASVKTHLRFRIRSHQQSTSPDDLQEQQSTPRHTRSAS
QSPPPHNGYDPAGTSDWPDHPPPHSDYSPDPPPPMFIPPAQPEENVDEKTRLRRAEEMLL
PSEPPPHEGDVAGPSSAPHGLPPSAPVLSEDDSNYQPANTRNNHNDFNPVNRNTSPSVSA
PSTDTITPTYCITNDHSPPSIPSGHPQAHAWPEAARNNASLNNTVPQSRVQDDKQELERQ
RLLNEASSPGDYGYARIHEGDFSNNFEPSAPALTEEDIFGHPVSGTQAEVEGESLPKYQR
GSWNS
Download sequence
Identical sequences A0A0J8RG53
CIHT_01674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]