SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CIHT_07501 from Coccidioides immitis H538.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CIHT_07501
Domain Number 1 Region: 11-172
Classification Level Classification E-value
Superfamily E set domains 0.00000343
Family Arrestin/Vps26-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CIHT_07501
Sequence length 228
Comment | CIHG_07467 | Coccidioides immitis H538.4 arrestin domain-containing protein (229 aa)
Sequence
MYNRPESSQKVSDHLVTLGISLPRWSYGPLDPVSVYVQLSPNPDWISKARKVTIQKLTLT
IDEEIIYNHEGDEPQRKVKTLAKRSESVGMKLPEAGYITNLGLVFPARDLRDSDGILPRS
KPGFPFYAVTSFTTTASLYKIEYYLTVKAHLTSAKDIVLRQPIVVCPQDHVGCKEEMEAI
EQAAREARHINPDNPMLPLPTIVRAHDPYALNYINVAIVGNVKKPLID
Download sequence
Identical sequences A0A0J8RWY8
CIHT_07501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]