SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CIST_09151 from Coccidioides immitis RMSCC 3703

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CIST_09151
Domain Number 1 Region: 3-373
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 1.05e-110
Family IF2B-like 0.000000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CIST_09151
Sequence length 390
Comment | CISG_09115 | Coccidioides immitis RMSCC 3703 methylthioribose-1-phosphate isomerase (391 aa)
Sequence
MTSALEAIRYKRGHLLIIDQLLLPHVTRFIPIRSAEDGWHSIKEMHVRGAPAIAIVAMLS
LAVEMSGLVSQQKISKNAEDTRVYIEEKLDYLATSRPTAVNLSDSVRKMKSVLEQKTRTL
TCSGEEIAMSFIAYAENMLVHDVADNRSIGEHGANWIVANTPSGVEDSKLCILTHCNTGS
LATAGYGTALGIIRHLHEKSQLCHAYCTETRPYNQGARLTAYELVSDQIPATLITDSMAG
QLLAKMGQSIAAIVVGADRVASNGDTANKIGTYTLAVLAKYHGVKFVVAAPRTTIDMGTR
TGKDIVIEERPHSEVTTITGPRERGDECGNIVMENIKIAADGINVWNPAFDVTPAALIDA
IVTEKGVEVKDANGRFHLGSLFETEVRPSN
Download sequence
Identical sequences A0A0J6YFS3 A0A0J8RCC6 C5PBM5 J3K3F3
CIST_09151 XP_001240294.2.59393 XP_003068154.1.1890 CIRT_05504 CIMG_07457T0 222929.C5PBM5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]