SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CPAT_03903 from Coccidioides posadasii RMSCC 3488

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  CPAT_03903
Domain Number - Region: 17-47
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 0.0863
Family Glutamine synthetase, N-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CPAT_03903
Sequence length 1378
Comment | CPAG_03883 | Coccidioides posadasii RMSCC 3488 5'-3' exoribonuclease 2 (1379 aa)
Sequence
MGVPKFFRWLSERYPAISQLIAENRIPEFDCLYLDMNGIIHNCTHKDSDSPTFRMTEDKM
FIAIFNYIEHLFGKIKPKKLFFMAIDGVSEDAEWQGVEVILSGHEVPGEGEHKIMEYIRQ
AKAQPDYDPNVRHCLYGLDADLIMLGLLSHDPHFCLLREEVTFGRQNQKKVKELEHQNFY
LLHLCIVREYLELEFQELEQEGALQFEFDMERVIDDFILMAFFVGNDFLPNLPNLHINEG
ALAWMFKVYKEVLPKLDGYINERGRINLNRLGVLLDSLGDVEFRFFEAEYSDSRWLKSKL
SRGEEKPEILDDPKALTISPAQKHILSKVKKYISHRPVNDDGYPVPLDLSPSLPARDRKF
VEQLADDLRISWSSVSNEHGDRFLRLQLPSKQRLANGDSASEDEDEEAQIAVLRVLKKYE
NAKVKETTAEEAQQIAEKKYEQKFQEWKNKYYEGKFGWGTDNDEEMRKLTENYVQGLQWV
LYYYYRGVASWPWFYRYHYSPMISDVKRGLAADMDFKLGQPFFPFQQLMGVLPDRSKKIV
PQAYHELMISPDSPIIDFYPRDFELDMNGKKMEWEAVVKIPFIDEDRLLKAMASKEHLLT
PEEKARNNFGVTLKFTHSPDIEFTYPSSFVGVFPDIPRCHCIENVYELPTMEGLEPYVGL
MDGVKLGTEALAGFPSLKTLPHTAQLGFHGVTVFQQESRNESMVVTLTEPESRSRAEIAK
SKIGKRVHIGYPFLHEALVVRVSDELFDYVQVDGEEHIVQIPHSPGQIDQWKKKSDRIES
SYSKRLGMIIGEVESIVHVHVLKGLVKTELGATVKEFAEIPGIETDYASQLIVDEVISQD
DRFIEREAVPIEEEFPEGTRAFFLGEYNYGAPVHITGHDDGKLQGLVSTTKGAKEPEFGK
EQVVIAESHSPYTPSFAVSRNLQLNPLTVAKITSSFSVMSEGKRINLGLNLKFEAKKLKV
LGYSRRGQNGWEFSEKAIGLLREYMIKFPEFIAGIQRKPQGDLFEPTDFYPPEVAATKIK
EIQSWLKSIEAKNFERVPLEAEQLDSDVVGAIEEAADKWFRNKPSPIPQKIRGVPRNAVL
KPADAEHRLGNQRFALGDRVIYAQDSGKVPIATKGTVVGLTRTSRTVLLDVIFDVSFMSG
TTLSGRCSPFRGQTVAASSVLNLTNKQLVAMTRAANEQAKAQQQRTSANQGYGAPLGPGG
RGQLKDAPTPPPLRGSFRSAINGHGSPRGNGLPRGRGAPHILPFRQHPQSDPARAQSSGV
HQTRSWRGRSNNQGSSSASQNMDSEMHKGTAPVRGRGRGASAAQLPHSRGGYVSVERVDP
TTDIIHNNPNFRPRPYNAVPPPTNLNHRGSHRGRGRGAPRGRGRGALGRGRGTATAES
Download sequence
Identical sequences A0A0J6FFA4
CPAT_03903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]