SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CPAT_05660 from Coccidioides posadasii RMSCC 3488

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  CPAT_05660
Domain Number - Region: 71-147
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0238
Family Capz alpha-1 subunit 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CPAT_05660
Sequence length 196
Comment | CPAG_05624 | Coccidioides posadasii RMSCC 3488 predicted protein (197 aa)
Sequence
MVQTGEKARKPKGVAGCGGKSQKLVPRVWANQNSPKVLTLVAYRHLRVYYAFSCDGFWRC
PVRYGCARCPVRNPRWLVPRRRQRFLVDDQNSLGGDLEPHVNPEQAGSERLTLQIMQSAS
TTSQFTQYRNMYNPDRFSGVILTSHEILQSTKILRSKQANSQRRVSGYPYAGAAVNIIAT
KAREGEGAQGITKFHA
Download sequence
Identical sequences A0A0J6F8H1
CPAT_05660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]