SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|337278423|ref|YP_004617894.1| from Ramlibacter tataouinensis TTB310

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|337278423|ref|YP_004617894.1|
Domain Number 1 Region: 1-103
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 8.72e-31
Family Frataxin-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|337278423|ref|YP_004617894.1|
Sequence length 111
Comment iron binding protein [Ramlibacter tataouinensis TTB310]
Sequence
MTDLEYMDQAEALLHAVEASCDRINEASDADIDNQRVGGMVTLTFPNGSQVIVNQQKPLH
EVWMAAKAGGFHYRFDGGQWRDTKTGSEFFADLSRYASQQAGQALRFVAPA
Download sequence
Identical sequences F5XY82
WP_013900108.1.47907 gi|337278423|ref|YP_004617894.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]