SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CPSG_00568T0 from Coccidioides posadasii str. Silveira

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPSG_00568T0
Domain Number 1 Region: 36-83,129-454
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.2e-49
Family AAT-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CPSG_00568T0
Sequence length 589
Comment | CPSG_00568 | Coccidioides posadasii Silveira aromatic amino acid aminotransferase (590 aa)
Sequence
MAGGVTDTHVPAPIQGNDDDPWRSKMGKPKLRPPRNFSHYYSFATKNRQGSSVKEFYKYF
AIPGIHNLAGGLPHVSYFPFDSLEATVAFPHRLPRESSSHRLQNPGRIVSTATSLPSRKV
TIPKESDTSDVLRKVDLATALQYGAIDGYPPLRSFIRQFVRENLLPSLPYEGGPEVILTC
GATDGLSKTIEIFTDVWVEDRDRIGERQGLLCEEFAYMNAIQTAQPRGINIVPVVVDSQG
MRVEGKGGLADVLDNWDFSRGRRPHLMYTVTLGQNPTGSVLPFDRRREIYAFCQKYDIII
VEDEPYWHLQYPSKGIAEHTDSNRDLHGQRSGYPFLDSLVRSYLSMDTDGRVVRLDTFSK
IIAPGCRLGWLTAQPSIVRRVLQISETSTQNPSGFVQSMVAQMIMGDQGDDIDRKSRASN
SPGWRMDGWVRWLEGLRGGYEKRMRTMCTILDEGKFSAIQGSISGDALELDEWEVVQNAQ
MFDFEWPGGDLSSRVSERSVEISDEKTIPPHCCSWLVNCTNRTSERSRVAVYASVHRANG
KNMMSQRAAIILLRAVVPFGRSRISTILMMMTITMPLLPHSCADGIKCN
Download sequence
Identical sequences E9CSK9
CPSG_00568T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]