SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CPSG_01729T0 from Coccidioides posadasii str. Silveira

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPSG_01729T0
Domain Number 1 Region: 111-519
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.85e-105
Family Pyridoxal-dependent decarboxylase 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CPSG_01729T0
Sequence length 572
Comment | CPSG_01729 | Coccidioides posadasii Silveira sphinganine-1-phosphate aldolase BST1 (573 aa)
Sequence
MTHPYIPITLHKVMAATRASSDALFSLSNLDLVRNLVFIVFLLRLSRRSFYTIRGQGFIG
TICNIYHKAHLTLYSLFLRAPGVRGQVDKQVSTAISKLESKLAPQGPGIVKYNKLPAQGW
SAEQVHAELDRLAGMEHTMWEEGRVSGAVYHGGEDLLKLQTAAWGQFAVANPIHPDVFPG
VRKMEAEVVAMVLELFNAPEGGAGVTTSGGTESILMACLSARQKAYTERGVTDPEMIVPI
TAHAAFNKAAQYFGIKLHSVPCPAPNYTVHIPSVRRLINPNTILLVGSAPNFPHGIVDDI
PALSRLAVSYKLPLHVDCCLGSFVIAFLKKSGFPSPYEEQGGFDFRLPGVTSISVDTHKY
GFAPKGNSVVLYRDRVLRSYQYFILPEWSGGVYASPSIAGSRPGALIAGCWSSLMAIGES
GYKDSCHQIVSAAKKFETSIREDPVLSRDLKVLGEPMVSVVAFATTTAEIDIYDIADAMS
AKGWHLNALQNPAAMHVAFTVPTANAVDQLTADLTEVVEIERAKADERKRLGQKVEKERG
DTSALYGVAGSIPDKSIVSRLAEGFLDTLYLS
Download sequence
Identical sequences E9CW96
CPSG_01729T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]