SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CPSG_03597T0 from Coccidioides posadasii str. Silveira

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPSG_03597T0
Domain Number 1 Region: 191-607
Classification Level Classification E-value
Superfamily PLP-dependent transferases 8.02e-97
Family GABA-aminotransferase-like 0.00000772
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CPSG_03597T0
Sequence length 670
Comment | CPSG_03597 | Coccidioides posadasii Silveira serine palmitoyltransferase 2 (671 aa)
Sequence
MPRRPTSSLVDISSNSSSSASTAPEKLSTTKPTNPSRNRFSQLLLSGPKPKSEAVSTSGG
GSHPRNGPAAVNGSSRLPTISLSTADAPSMDSSATTTLFQPPSPHEAHRIAKQHAQFGPL
GHPTHRYTSRHQGGAFPDPIMDEPPYFYLLTTYISYLILIAFGHVRDFFGKRFKEKDYRH
LKPQNGYGALNSDFDNFYVRRLKLRINDCFERPVTGVPGRYITLIDRVSDDQNRHFRFTG
TTTDTLNMSSYNYLGFAQSEGPCADAVEQTIRKYGISSVGTRVDAGTQDLHVEVEDLVAR
FVGKEASMVFSMGFGTNASIFPALVSKGCLIISDELNHASIRYGARLSGASIEMFKHNDV
NALEKKLREVISQGQPRTHRPWKKILLVVEGLYSMEGSMCNLPGILALKKKYKFNLFIDE
AHSVGAIGPRGRGICDYFGIDTKEVDILMGTLTKSFGANGGYIAADKVVIDKLRASNAAV
FFGEAPTPPILAQISTSLRIITGELVPGQGEERLQRLAFNSRYLRLGLKRLGFIVYGNDD
SPIIPLLLFNPAKMPAFSHEMLKRKISVVVVGYPATPLVSSRARFCVSAAHTKDDLDRLL
SACDEIGNVLQLKFSSGVAGGALPPPDGVSPEMENDWYRQQTTAGKITPPRWRYEDVVRR
GVQDVKQPLR
Download sequence
Identical sequences C5PCT8 E9D1Z9
222929.C5PCT8 XP_003067044.1.1890 CPSG_03597T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]