SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CPSG_04431T0 from Coccidioides posadasii str. Silveira

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPSG_04431T0
Domain Number 1 Region: 40-393,421-502
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.4e-122
Family Pyridoxal-dependent decarboxylase 0.000000163
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CPSG_04431T0
Sequence length 558
Comment | CPSG_04431 | Coccidioides posadasii Silveira glutamate decarboxylase (559 aa)
Sequence
MHLATHVNPEEVIEQLRNDPEESHRRHVFTLNAVATRTAYSTRYASSEEIPKFRIPQLGA
SAEAVYRLLRDELDLDGIPNLNMASFVGTFMEREAQQLLVENISKNLADADEYPALMDLH
ARCISMIANMWHPRPGEQPIGTATTGSSEAIQLGGLAMKRRWQEKRRAEGKDTSKPNILM
GANAQVALLKFARYFDVEARILDVSENSHYRLDPNDIKKNVDENTIGIFVILGSTYTGHY
EPVEELSRILDQVQEEHGWDIPIHVDAASGGFIAPFVHAGAGGSKWDFELSRVHSINVSG
HKFGLVYVGLGWIIWRDRAYLPKDLIFELHYLGGTEESFGLNFSRPGIQVIGQYYNLIRL
GFDGYREVMENCLQNARLLSKALERTGWYVCVSDIHRKKGDYRFRGVGEIQPHRPGETSA
DYNEGLPVVAFRFSEQFKKEYPDVKQEAISLLLRAKQYIIPNYPLPPKTDNIEILRVVVR
ESMSGDLIDKLISDIVEVTERVMTSEPIDVAVLQSRPTSLARRHGRLETKLPAKKITKVK
AGEKACHPMAKGGHRSVC
Download sequence
Identical sequences A0A0J6FLK4 C5NZG0 E9D492
CPAT_07582 XP_003071998.1.1890 222929.C5NZG0 CPSG_04431T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]