SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CPSG_07050T0 from Coccidioides posadasii str. Silveira

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPSG_07050T0
Domain Number 1 Region: 150-552
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.67e-102
Family GABA-aminotransferase-like 0.00000001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CPSG_07050T0
Sequence length 635
Comment | CPSG_07050 | Coccidioides posadasii Silveira 5-aminolevulinate synthase (636 aa)
Sequence
MEALLQQSRSLCPFLSKTSPSTLRSLSTSTRPHASSPGGGTISNLQVIAKRCPIMSKALA
VQSSRMAAGCPIKGLGAAMRVSVHGKRAMHTSAVRHANVRDEVNKKAQRVPPVLLSNKPS
DALKRDTVCPGPKPAVPPAGKFDYEAFYAAELEKKHKDKTYRYFNNINRLAREFPKAHMA
TSGDRVTVWCANDYLGMGRNPYVLRTMHETLDNYGAGAGGTRNISGHNQHAVALEDTLAR
LHRKESALVFTSCYVANDATLATLGSKLPDCVILSDSLNHASMIQGIRHSGAKKMVFKHN
DLQDLENKLASLPPSTPKIIAFESVYSMCGSIAPIEEICDLAEKYGAITFLDEVHAVGMY
GPHGAGVAEHLDYDVHASAPENIKGTVMDRIDIITGTLGKAYGCVGGYIAGSARFVDTIR
SLAPGFIFTTSLPPATMAGAATSIKYQAGYGRDRTLQQLHTRAVKAELNASDIPVIPNPS
HIIPILVGDAEVAKRASDMLLEDYGIYVQAINYPTVPRGEERLRVTPTPGHIKPLRDHLV
ASLKQVWERLGIRKTSDWKKVGGFLGVGDEAAVKDAKNQPMWTDEQLGLAQGEDVEAALR
RELQAETIDKQRMLNELAEPVGMSTPVAPAVKVTA
Download sequence
Identical sequences E9DB48
CPSG_07050T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]