SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CPSG_08262T0 from Coccidioides posadasii str. Silveira

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPSG_08262T0
Domain Number 1 Region: 1-499
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.86e-119
Family Pyridoxal-dependent decarboxylase 0.0000000146
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CPSG_08262T0
Sequence length 514
Comment | CPSG_08262 | Coccidioides posadasii Silveira aromatic-L-amino acid decarboxylase (515 aa)
Sequence
MDAEQFRQAAQSAIEEIIEHFNTLPSRRVLPNIEPGYLRPLLPQSPPKEPESWEQIRLDI
ESKIKPGLTHWQSPHFMAFFPALVTYPSILGEMYSAAFSAPAFNWLCSPACTELEIVVLD
WVAQAIGLPECFHSTGPTKGGGVIQGSASEAVVTVMVAARERMLRDLAAAEGLKEDTPEW
EDKVMSIRGNLVALGSDQAHSCTAKGARIVGTRYRSVPTALSDNFEVTRASLRKVLEECE
AAGLVPYYLTTTLGTTSTCATDRFAEIKAVLASKPSWQKIWVHIDAAYAGAALVTPEYQP
IAREWDSGIDSFNFNMHKWLLVNFDASCLFVRNRTDVTSAMDITPAYLRNPYSELPDTVD
FRNWQIPLGRRFRALKIWFVMRAYGLSGMRAFIYKGLHHGDVFVEMCRGRKDLFTIVTPP
AFGLTVFRVTDEAAAAACGSTSAAITREVYEKINAGGEIFITSSVVGGIYVIRVVSGSWL
SEEKYVRRAFDIIAKTTEETLAGKKTNGVETLRN
Download sequence
Identical sequences E9DEL2
CPSG_08262T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]