SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CPSG_08691T0 from Coccidioides posadasii str. Silveira

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPSG_08691T0
Domain Number 1 Region: 33-467
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.89e-136
Family Pyridoxal-dependent decarboxylase 0.0000000137
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CPSG_08691T0
Sequence length 517
Comment | CPSG_08691 | Coccidioides posadasii Silveira glutamate decarboxylase (518 aa)
Sequence
MVHLAAVRKDSEVLPVRMVKRVDTIPLEEPQEHDFFSSVYGSRFAAEDLPTHEMPEKEMP
REVAYRMIKDELSLDGNPMLNLASFVTTYMEEEAERLMAESFSKNFIDYEEYPQSAEIQN
RCVNMIARLFNAPASDESDHAMGTSCVGSSEAIMLGTLAMKKRWQNKRKAEGKDYSRPNI
IMSSAVQVCWEKAARYFDVEEKFVYCTSERYVIDPEEAISMVDENTIGICAILGTTYTGQ
YEDIKALNDIMIEKGIDCPIHVDAASGGFVAPFVNPNLEWDFRLEKVVSINVSGHKYGLV
YPGVGWVVWRSPEYLPKELVFNINYLGANQASFTLNFSKGASQVIGQYYQMIRLGKRGYR
SIMVNLTRTADYLASALRQLGFIIMSDGKGHGLPLVAFRLNPDDENVMYDEFALAHQLRE
RGWVVPAYTMAPHSEKLKLMRIVVREDFSKSRCDNLVNDIKLALQQLGDMDKRTLERFQQ
HIRRHVTNSGSATHNHPQYQDEDHSLQGKTGKTHAIC
Download sequence
Identical sequences E9DFU2
CPSG_08691T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]