SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004622 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004622
Domain Number 1 Region: 204-261
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.34e-21
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 2 Region: 318-367
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.13e-21
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 3 Region: 371-425
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.96e-20
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 4 Region: 1-42
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.35e-19
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 5 Region: 267-315
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.76e-18
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 6 Region: 424-480
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.57e-16
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 7 Region: 174-218
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000171
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004622   Gene: ENSDORG00000004938   Transcript: ENSDORT00000004938
Sequence length 487
Comment pep:novel scaffold:dipOrd1:scaffold_20642:3670:7505:1 gene:ENSDORG00000004938 transcript:ENSDORT00000004938 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTFENVAVDFTQEEWRCLTPAQRALYRDVMLDTYRNLVSVDTSPRYILKDLPPQASRREI
SQSWGQSNDEFSCEEIQKAPHEWEWSATDGCAKGVLMVHREEGSGRGEQEGGGHAGKQTT
SPWLGQPLQEHLRRLSPYLCEGGGEDLEKSAHQGPHVPQGSPSSGNTHIVHACDDASICS
PLRTHTPKVHIQEKPYQCRECGKAFSQDSSLIMHWRTHAGERPYCCATCGKAFLQKSGLM
RHKRTHATERPYACGLCGKAFRTWQAPHQTVHSDQKPHRCSVCGKAYRQSSSLVIHHRMH
TGERPFVCDTCGKAFIASLIQHQVVHTGARPYRCTQCGKTFTQNSPLMRHRRTHTGEKPY
TCDTCGKVLSSRKSLNEHQAVHTGVKPYRCAQCGKMFTRNAQLVCHRRTHTGEKPFVCAD
CGRAFASHFSLTTHRTIHTDLKPYQCNECGKAFKLRTHLKRHLRHTRERGDVCDTCGKVF
SRSPNLT
Download sequence
Identical sequences ENSDORP00000004622 ENSDORP00000004622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]