SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000011880 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000011880
Domain Number 1 Region: 506-562
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.03e-20
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 2 Region: 2-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.09e-18
Family KRAB domain (Kruppel-associated box) 0.0024
Further Details:      
 
Domain Number 3 Region: 414-470
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.27e-18
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 358-410
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.07e-16
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 5 Region: 549-603
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000113
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 6 Region: 460-492
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000836
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000011880   Gene: ENSDORG00000012632   Transcript: ENSDORT00000012634
Sequence length 630
Comment pep:novel scaffold:dipOrd1:scaffold_34162:6140:9935:-1 gene:ENSDORG00000012632 transcript:ENSDORT00000012634 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPLTFEDVAIYFSEQEWQHLQTWQKMLYKHVMKTNYETLVSLDGDLSKPELILWIEHGRE
PFKSWEETQKLDSIMHSSAEAHFDPVTEQKLLQQAVESGKCHFQLDPFQDYGSSGPFISF
RPESGLGHVTPQRLDTLPLAAVAHGSSMSAHEEEIPKHRAVGLPGPQEAPSWPSVPRPRL
VCGENFGKKNHLVRHHVGHAKDPPGRAGRKATGPAEAQRPWDVVGAPRPLPCPACGRSSQ
GKRYLLRRLARKSPAPGPKCNVCSHPEQPLSCHPVPREGPEPSREPLGPATPKDSPLGAP
TSWRGEGRPVSRASGQARGRPRGARAPADSSFQGAQGEARSGLRSLLRASLPGHGDARPL
PCGECGRAFSHPCKLREHLRLHSGERPFRCPDCGKSFRLRGVLRAHQRTHSAPRPFPCAQ
CGKGFSRPSSPHLRLHSGERPFPCPQCGRRFRLRGQLRSHQRLHTGERPFRCADCGKSYR
VKADLKAHQLLHGAQMPFPCQCGKGFAKRSKLVEHVRTHTGEKPFPCPECGKAFRLRTQL
LSHRGLHTGQRPFRCPECGKDFGEGHLLRHQRIHRPERPFACGDCGKGFLYKSKLAAHVR
VHAKPCRAPREPDVQKRRSQLFAMIEADWS
Download sequence
Identical sequences ENSDORP00000011880 ENSDORP00000011880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]