SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012067 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012067
Domain Number 1 Region: 324-381
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.07e-24
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 2 Region: 212-269
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.8e-24
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 3 Region: 268-325
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.85e-24
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 4 Region: 519-576
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.89e-23
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 5 Region: 10-68
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.35e-22
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 6 Region: 170-222
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.11e-21
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 7 Region: 370-422
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.96e-20
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 8 Region: 482-533
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-18
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 9 Region: 139-185
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000143
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 10 Region: 575-622
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000103
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012067   Gene: ENSDORG00000012830   Transcript: ENSDORT00000012830
Sequence length 626
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_3095:24678:34628:1 gene:ENSDORG00000012830 transcript:ENSDORT00000012830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPSPPVEPKGLLTFEDVAVFFTQEEWEYLDPAQRSLYKDVMVENYGNLVSLDVLNRDK
HEEPIVKQEIEEIEEDVEPQGVIVTRIKSEIEQDPMGQETFELVGRLDKQRGIFLWEIPR
ESLTQEQKIFRENTNIIRKRPNSEEKCHKCEECGKGFVRKAHFIQHQRVHTGEKPFQCNE
CGKSFSRSSFVIEHQRIHTGERPYECNYCGKTFSVSSTLIRHQRIHTGERPYQCNQCKQS
FSQRRSLVKHQRIHTGEKPHKCSDCGKAFSWKSHLIEHQRTHTGEKPYHCTKCKKSFSRN
SLLVEHQRIHTGERPHKCGECGKAFRLSTYLIQHQKIHTGEKPFLCIECGKSFSRSSFLI
EHQRIHTGERPYQCKECGKSFSQLCNLTRHQRIHTGDKPHKCEECGKAFSRSSGLIQHQR
IHTREKTYPYSETKEFDPNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XPYLCTVCGKSFSRSSFLIEHQRIHTGERPYLCRQCGKSFSQLCNLIRHQGVHTGNKPHK
CEECGKAFSRNSGLIQHQRIHTGEKPYKCEKCDKSFSQQRSLVNHQKIHAEMKTQETHEC
DACGEAFTCRISLMQHQKLHTAWMQQ
Download sequence
Identical sequences ENSDORP00000012067 ENSDORP00000012067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]