SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014519 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014519
Domain Number 1 Region: 340-397
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.35e-26
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 2 Region: 284-341
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.91e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 22-83
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.05e-23
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 4 Region: 228-285
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.99e-22
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 5 Region: 382-434
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.24e-17
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 6 Region: 198-242
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000418
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014519   Gene: ENSDORG00000015427   Transcript: ENSDORT00000015427
Sequence length 439
Comment pep:novel scaffold:dipOrd1:scaffold_18287:13130:21772:1 gene:ENSDORG00000015427 transcript:ENSDORT00000015427 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GADLCAALPFSGVFRNKIKAKAMAQEAVVFSDVSIDFSQEEWECLTDGQRDLYRDVMLET
YSILVSMGHSISKPHVILYLEQGKEPWLGDGELTRGQWSVLESPETKKSFLQKEICEVGL
SPWELMGRLAKGDISDSGCQDEWECNGQVEKHPGSQMKHFSELIITSDDMPSFSQHPSFT
LQHIINNKEKYCATKENRKSFRPGSHLTPHEIIHTIEKPYECKECGKTFRHPSRLAHHEK
IHTGKKPFECKECGKTFICGSDLTRHHRIHTGEKPYECKECGKAFSSGSNFTRHQRIHTG
EKPYECKECGKAFSSGSNFTQHQRIHTGEKPYECKECGNAFSQSSQLIKHQRIHTGEKPY
ECKQCEKAFRSGSDLTRHQRIHTGEKPYECKICGKAYSQSSQLISHHRVHTGEKLYEYRE
CEKNFDYGSQLLQHQNLYW
Download sequence
Identical sequences ENSDORP00000014519 ENSDORP00000014519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]