SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001458 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001458
Domain Number 1 Region: 109-216
Classification Level Classification E-value
Superfamily EF-hand 7.86e-39
Family Osteonectin 0.00000182
Further Details:      
 
Domain Number 2 Region: 55-110
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000943
Family Ovomucoid domain III-like 0.0000361
Further Details:      
 
Domain Number 3 Region: 30-54
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000055
Family Follistatin (FS) module N-terminal domain, FS-N 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001458   Gene: ENSDORG00000001562   Transcript: ENSDORT00000001561
Sequence length 218
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_1844:4859:13138:-1 gene:ENSDORG00000001562 transcript:ENSDORT00000001561 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPVGANPVQVEVGEFEDGAEEAVEEVVADNPCQNHHCKHGKVCELDESNTPMCVCQDPTS
CPAPVGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKVKKIHENEKR
LEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPNDGYLSHTELAPLRAPLIPMEHC
TTRFFEACDLDNDKYIALDEWAGCFGIKEQDINKDLVI
Download sequence
Identical sequences ENSDORP00000001458 ENSDORP00000001458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]