SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002841 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002841
Domain Number 1 Region: 613-868
Classification Level Classification E-value
Superfamily YWTD domain 1.7e-56
Family YWTD domain 0.00000656
Further Details:      
 
Domain Number 2 Region: 312-542
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-50
Family YWTD domain 0.00000259
Further Details:      
 
Domain Number 3 Region: 2-201
Classification Level Classification E-value
Superfamily YWTD domain 3.01e-41
Family YWTD domain 0.00000771
Further Details:      
 
Domain Number 4 Region: 915-1176
Classification Level Classification E-value
Superfamily YWTD domain 9.16e-39
Family YWTD domain 0.0000791
Further Details:      
 
Domain Number 5 Region: 1307-1343
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000668
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 1269-1305
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000055
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 1229-1267
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000563
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 8 Region: 568-614
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000144
Family EGF-type module 0.011
Further Details:      
 
Domain Number 9 Region: 871-922
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000167
Family EGF-type module 0.023
Further Details:      
 
Domain Number 10 Region: 266-309
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000577
Family EGF-type module 0.01
Further Details:      
 
Domain Number 11 Region: 1186-1238
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000936
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002841   Gene: ENSDORG00000003026   Transcript: ENSDORT00000003026
Sequence length 1587
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_4496:15170:79738:1 gene:ENSDORG00000003026 transcript:ENSDORT00000003026 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPLLLFANRRDVRLVDAGGVKPESTVVVSGLEDAAAVDFLFSTGAVYWTDVSEEAIKQAY
LNQTGVAHTVVISGLVSPDGLACDWVGKKLYWTDSETNRIEVSNLNGTSRKVLFWQDLDQ
PRAIALDPAHGYMYWTDWGETPRIERAGMDGSARKIIVDSDIYWPNGLTIDLEEQKLYWA
DAKLSFIHRANLDGSFRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXLYSPMDIQVLSQERQPPFHTQCEEDNGGCSHLCLLSPREPFYTCACPTGVQLQDN
GRTCKAGAEEVLLLARRTDLRRISLDTPDFTDIVLQVDDIRHAIAIDYDPLEGYVYWTDD
EVRAIRRAYLDGSGAQTLVNTEINDPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSRKI
LVSEDLDEPRAIVLHPVMGLMYWTDWGENPKIECANLDGRERHVLVNTSLGWPNGLALDL
QEGKLYWGDAKTDKIEVINVDGTERQTLLEDKLPHIFGFTLLGDFIYWTDWQRRSIERVH
KVKASRDVIIDQLPDLMGLKAVNVAKVFGTNPCAEGNGGCSHLCFFTPQATKCGCPIGLE
LLSDMKTCIVPEAFLVFTSRATIHRISLETNNNDVAIPLTGVKEASALDFDVSNNHIYWT
DVSLKTISRAFMNGSSVEHVIEFGLDYPEGMAVDWMGRNLYWADTGTNRIEVARLDGQFR
QVLVWRDLDNPRSLALDPTKGYIYWTEWGGKPRIVRAFMDGTNCMTLVDKVGRANDLTID
YADQRLYWTDLDTNMIESSNMLGQERVVIADDLPHPFGLTQYSGYIYWTDWNLHSIERAD
KTSGQNRTLIQGHLDFVMDILVFHSSRQDGLNDCTHNNGQCGQLCLAVPGGHRCACASHY
TLDPSSRNCSPPSTFLLFSQKCAISRMIPDDQHSPDLVLPLHGLRNVKAIDYDPLDKFIY
WVDGRQNIKRAKDDGTQPFVLTSPGQSQGQGQSPDRQPHDLSIDIYSRTLFWTCEATNTI
NVLRLDGDAMGVVLRGDRDKPRAIAVNAERGYLYFTNMQDRAAKIERAALDGTEREVLFT
TGLIRPVALVVDNSLGKLFWVDADLKRIESCDLSGANRLTLEDSNIVQPVGLTVLGRHLY
WVDRQQQMIERVEKTTGDKRTRVQGRVAHLTGIHAVEEVSLEEFSAHPCARDNGGCSHIC
IAKGDGTPRCSCPVHLVLLQNLLTCGEPPTCSPDQFACATGEIDCIPGAWRCDGFPECDD
QSDEEGCPVCSAAQFPCARGQCVDVRLRCDGEADCQDRSDEADCDAVCLPNQFRCASGQC
VLIKQQCDSFPDCVDGSDELMCEITKPSSDDIPAHSSAIGPVIGILLSIFVLGGVYFVCQ
RVVCQRYAGANGPFPHEYVSGTPHVPLNFIAPGGSQHGPFTGISCSKSMMSSVSLVGGRG
GMSLYDRNHVTGASSSSSSSTKATLYPPILNPPPSPATDPSLYNMDTFYSSNIPATTRPY
RPYVIRGMAPPTTPCSTDVCDSDYSASRWKASKYYLDLNSDSDPYPPPPTPHSQYLSAED
SCPPSPATERSYCHLFPPPPSPCTDSS
Download sequence
Identical sequences ENSDORP00000002841 ENSDORP00000002841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]