SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004990 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004990
Domain Number 1 Region: 97-312
Classification Level Classification E-value
Superfamily Urocanase 1.83e-89
Family Urocanase 0.00000792
Further Details:      
 
Domain Number 2 Region: 573-722
Classification Level Classification E-value
Superfamily Urocanase 1.18e-53
Family Urocanase 0.00015
Further Details:      
 
Domain Number 3 Region: 374-485
Classification Level Classification E-value
Superfamily Urocanase 1.05e-31
Family Urocanase 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004990   Gene: ENSDORG00000005334   Transcript: ENSDORT00000005334
Sequence length 747
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_4400:301:14140:-1 gene:ENSDORG00000005334 transcript:ENSDORT00000005334 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HRWSLPPSQREMSSLQELCSGLPLHPLPENRGRRPGVPHAPVRTPGLSPEEEQLALRNAL
RYFPPGAQELLAPEFAQELRLYGHIYMYRLCPSMELKAYPLDQYPCRTKAAAAIMHMIMN
NLDPAVAQFPQELVTYGGNGQVFSNWAQFWLTMSYLSKMTEEQTLVMYSGHPLGLFPSSP
GAPRLVITNGMVIPNYSSRTEYEKLFALGVTMYGQMTAGSYCYIGPQGIVHGTVLTVLNA
GRRYLGVEDLAGKVFVTSGLGGMSGAQAKAAVIVGCIGVIAEVDKAALVKRHQQGWLMEV
TDSLDHCIARLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXPSRVARKNKEVLSLGYHGNVVDLWERLVHELDTTGELLVDLGSDQTSCHNP
FNGGYYPVQLSFSEAQSLMASNPAAFKRLVQESLRRHVDAINRLAREKLFFWDYGNAFLL
EAQRAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVVGSQARILYSDQKGRVAIAVAINQA
IASGTIKAPVVLSRDHHDVSGTDSPFRETSNIHDGSAFCADMAVQNFVGDACRGATWVAL
HNGGGVGXXXXXXXXXXXXXDGTPEAEEKARMMLSWDVSNGVARRCWSGNSKAYDIICQT
MRENSGLVVTLPHQVADEHLLQRALQP
Download sequence
Identical sequences ENSDORP00000004990 ENSDORP00000004990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]