SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005798 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005798
Domain Number 1 Region: 5-64
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.8e-24
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 2 Region: 388-442
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.55e-23
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 336-389
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000235
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 4 Region: 228-279
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000341
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 5 Region: 268-325
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000684
Family Classic zinc finger, C2H2 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005798   Gene: ENSDORG00000006195   Transcript: ENSDORT00000006193
Sequence length 456
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_6468:5889:8303:-1 gene:ENSDORG00000006195 transcript:ENSDORT00000006193 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VNSKKGHVSFKDVCVDFTKEEWYLLDPAQKIMYRDVILENYSNLVSVGHCVTKPEVIYKI
EQGEEPWILEKGSSGQNHSEKKWKDDDLLESSQENQDEHFWQLIVTNNKPVSVEGGDKLR
KTLNLDTDQMSSRNCPFKICDTCEMSLKNISDLIISKKNYSKKKSDEFNVCEKLVLDIRS
EKIPVGEKPCKYNQKRNILRHHQDLIQPIFDQPFIYNKNGQGFHEEASSFTSQRCQIGET
LCKYTECGRTFIDSLKLNVSQRTHWEMEPYECSICGKLFYVDLQVGHQRAPSEDSNYEYN
EFGEIICDSSTFIIHQGAYTRKTPHEYKLNDKAWEKSALFKHQIVHMGGKPYPCPESRNH
FSKKPHLPQSRRAHLGEKTFECGECGKTFWEKSNLTQHQRTHTGEKPYECTECGKAFCQK
PHLTNHQRTHTGEKPYECKQCKTFCVKSNLTEHQRT
Download sequence
Identical sequences ENSDORP00000005798 ENSDORP00000005798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]