SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005825 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005825
Domain Number 1 Region: 354-406,444-568
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000275
Family Voltage-gated potassium channels 0.021
Further Details:      
 
Domain Number 2 Region: 591-669
Classification Level Classification E-value
Superfamily EF-hand 0.0000123
Family Calmodulin-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005825   Gene: ENSDORG00000006223   Transcript: ENSDORT00000006223
Sequence length 799
Comment pep:novel scaffold:dipOrd1:scaffold_12773:3629:26841:-1 gene:ENSDORG00000006223 transcript:ENSDORT00000006223 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSMGGPEGQELHKLDKGAWDNPAYSSSPSPHGTPRIYTVSSVASPSNEPLPKKPEDGVQ
EKTHSTLGSSCCLHICHCIRGLWGTTLTENTAENRELYVKTTLRELLVYIVFLVDICLLT
YGMTSSSAYYYTKVMSELFLHTPSETGVSFQTISSMADFWDFAQGPLLDSLYWTKWYNNQ
SLGHGSHSFIYYENLLLGAPRLRQLRVRNDSCVVHEDFREDIFSCYDVYSPDKEEQLPFG
SVNGTAWTYHSQDELEGSSHWGRLTSYSGGGYYLDLPGSRQASAEALRDLQEGLWLDRGT
RVVFIDFSVYNANINLFCVLRLVVEFPATGGAIPSWQIRTVKLIRYVSNWDFFIIGCEII
FCIFIFYYVVEEVLEIHMHRLGYLSSIWNILDLVVILLSMLAVGFHIFRTLEVNRLMGKL
LEQPNTYADFEFLALWQTQYNNMNAVNLFFAWIKIFKYISFNKTMTQLSSTLARCAKDIL
GFAIMFFIVFFAYAQLGYLLFGTQVENFSTFTKCIFTQFRIILGDFDYNAINNANRILGP
VYFVTYVFFVFFVLLNMFLAIINDTYSEVKEELAGQKDELQLYDLLKQGYKKTLLRLRLK
KEQVSDVQKVLQGGKQEIQFEDFTNTLRELGHEEHEITELTAAFTRFDQDGNHILDEKEQ
EQMRQDLEEERVALNAEIENLGRSIVHSPAGELGTEAATSEGWVSGEEFYTLTRVLQLET
ALEGVISQIDAVDSKLKMLERKGQPASSPGEEEAVWEHLHPAVVIPAPGVGGHKSEFCKR
ETLEESRLLLQGKIPIQRS
Download sequence
Identical sequences ENSDORP00000005825 ENSDORP00000005825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]