SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000006583 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000006583
Domain Number 1 Region: 398-572,605-696
Classification Level Classification E-value
Superfamily Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 1.83e-54
Family Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 0.00043
Further Details:      
 
Domain Number 2 Region: 1118-1173
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 1.05e-20
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00011
Further Details:      
 
Domain Number 3 Region: 702-744
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.000000000000146
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000006583   Gene: ENSDORG00000007023   Transcript: ENSDORT00000007023
Sequence length 1173
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_5279:244524:309607:1 gene:ENSDORG00000007023 transcript:ENSDORT00000007023 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCTPNPGSWVTFDDDSAFQSSQKPKNFPSENQGVCRPNGLKLNLPGLREFPSGSSSTSST
PLPSPSVDFYFSPGPPSNSPLSTPTKDFPGFPGIPKAGTHVLYPIPESSCPPTTVGACSS
VPPMTPTCISPDHSCMLPAPRVDIPDRTSPQQAQHLGSQSDAPQFQYFREDCAFSNPFWK
DGGGASQVTFDPSGSRKTFSSRDKEMPIDQKSLNKCSLNYICEKLEHLQSTENQDPLGNV
FIQDVDVEDPHSSFIPHMLFRSQPKAGWSFMMRIPEKKNMMSSRQWGPIFLKVLPGGILQ
MYYEKGLEKPFKELQLDPYCRLSEPKVENFSVTGKIHTVKIEHVSYTEKRKYHSKTEIVH
EPDIEQMLKLGSTEYRDFLDFLTTVEEELMKLPAISKPKKSYEEQEISLEIVDHFWGKVT
REDGKLVESAVITQISCLCFVNGNMECFLTLNDLELQKQDENSFENDPEKKGIHILDYHF
HKCVKASEFEQSRVIKFMPLDACKFELMRFKSLYEGDELPFSLKSAVVVQGASVELQAFV
NMAPVAQRPSQANSLRYCDNITIHFPVPSQWVKALWTMNLQRQKSLKAKMNRRACLGGFY
ELESEPAVLVTVGSAKYDSAYRAVVWKIDRLPDKNSSPDHPHCLSYKLELGSDQEIPSDW
YPFATVQFSMPDTYASRTAVQSLGVESDIQPQKHVLQRACFNLQPKLYRSVIEDVIEGVR
ELFAEEGIEEQVLKDLKQLWETKVLQSKATEDFFRNNIHSPLFTLQMPHNFHQTLQPTAS
LVIPAGRTLPSFVPAELGTSGSSANFAFPGYPIHVPAGVTLQTPSGHLYKVNVPIMVTQT
SGRTGVVQPPVQQVFQQLGQPSIIQTSIPRPNPCSIQATPDKQQRVETVLHQPTILHSVP
IDRKQLETTTSSLLVSPGNEHKVRSEAFLSQQESSQYMGLRGPGFPSQVSQTDSKVEPVL
RVSANMTQNLHGGLSLGPPGAPCHYVTDARLYGINSRMYGCDSITQPRKVEAAGGLPVSE
KXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXDPLNSGDDASEQDVPDLFDTDNVIVCQYDKIH
RSKNKWKFYLKDGVMCFGGRDYVFAKAIGDAEW
Download sequence
Identical sequences ENSDORP00000006583 ENSDORP00000006583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]