SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000010681 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000010681
Domain Number 1 Region: 577-743
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.7e-45
Family YicI catalytic domain-like 0.0014
Further Details:      
 
Domain Number 2 Region: 745-824
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.08e-20
Family Putative glucosidase YicI, domain 3 0.01
Further Details:      
 
Domain Number 3 Region: 88-177,264-393
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.00000000000000408
Family YicI N-terminal domain-like 0.016
Further Details:      
 
Domain Number 4 Region: 396-457
Classification Level Classification E-value
Superfamily (Trans)glycosidases 0.000000197
Family YicI catalytic domain-like 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000010681   Gene: ENSDORG00000011363   Transcript: ENSDORT00000011363
Sequence length 964
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_887:1267:23629:-1 gene:ENSDORG00000011363 transcript:ENSDORT00000011363 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVAAVAARRRRSWTGLVLACLGVCLGITFAVDRSNFKTCEESSFCKRQRNIRPGLSPY
RALLETLQLGPDSLTIHLIHEVTKVLLVLELQGLQKNMTRIRIDELEPRRPRYRVPDVLV
ADPPAARLSVSGHDDNSVELTVAEGPYKIILTAQPFRLDLLEDRSLLLSVNARGLMEFEH
QRAPRVPFSDKVSLTLGSIWDKIKSLFSRQGSKDPAEGDGAQPEETPGDGDKPEETQGKA
EKDEPGAWEETFKTHSDSKPYGPTSVGLDFSLPGMEHVYGIPEHGDSLRLKVTEGGEPYR
LYNLDVFQYELDNPMALYGSVPVLLAHNPHRDLGIFWLNAAETWVDISSNTAGKTLFGKM
LDYLQGSGETPQTDVRWMSESGIIDVFLLLGPSVFDVFRQYASLTGTQTLPPLFSLGYHQ
SRWNYRDEADVLEVDGFDDHNMPCDVIWLDIEHADGKRYFXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMLKDAQHYGGWEHRDIHNIYGFYV
HMATANGLIQRSGGIERPFVLSRAFFAGSQRFGAVWTGDNSAEWDHLKITIPMCLSLGLV
GLSFCGADVGGFFKNPEPELLVRWYQMGAYQPFFRAHAHLDTGRREPWLLATQNQDVIRD
ALNQRYSLLPFWYTIFYQAHREGFPVMRPLWVQYPQDVTTFSMDDQFLLGDALLVHPVSD
AGAHGVQVYLPGQGEVWYDSQTYQKYHGPQTLYLPVTLSSIPVFRGGTIVPRWMRVRRSS
DCMKDDPITLFVALSPQGTAQGELFLDDGHTFNYQTRNEFLFRRFSFSGNTLVSSSADPK
GHLETPIWIERVVIIGAGKPAAVVLQTKGSPETRLSFQHDPETSVLILRKPSVNVASDWS
IHLR
Download sequence
Identical sequences ENSDORP00000010681 ENSDORP00000010681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]