SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000012786 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000012786
Domain Number 1 Region: 26-486
Classification Level Classification E-value
Superfamily ALDH-like 3.4e-91
Family ALDH-like 0.00000419
Further Details:      
 
Domain Number 2 Region: 499-768
Classification Level Classification E-value
Superfamily ALDH-like 8.64e-41
Family ALDH-like 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000012786   Gene: ENSDORG00000013597   Transcript: ENSDORT00000013598
Sequence length 802
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_6810:244940:277985:1 gene:ENSDORG00000013597 transcript:ENSDORT00000013598 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATRAGARVSEIFTTMEYGPAPESRACALAWLDTHDRQLGHYIHGLWIKPEHRNSVPFQ
DPITGEILASCLEATADDVASAVNAANTAFVGWRTLPGASRAQHLTRLAKNIQKHQRLLW
TLESLVTGRAVREVRDQEVPLAQQLLQYHAVQAHAKSEILAAWAPMGVIGLILPPTFSFI
DMMWRICPALAMGCTVVALVPPGSPTPLLLAQLAGELGSFPGILNVLSGPASLGQVLAAQ
PGVQKVFFCGAVEEGRALRRTLAGQGVELSLALGSESLLLLTDSADLDSAVEGVVDAAWS
DRSQGGLRLLIQESVWDETMQRLQARMGRLRCGPGLDAAVDMGARGTAAYDLAQCYVREA
QSQGGQVFQAGDMPLDSPFYPPTLVSGLPPASPSAQAEVPWPLVVASPFRTAKEVLALAN
GTPWGGNASVWSERLEQALELGYGLQVGTVWINAHGLRDPAVPTGGCKESGCSWHGELDG
LHEYLRSSVTPAPKPFFCESLNYDTFGLVVPPTLPAGPEVGPSPAPPYGLFVGGRFQPPG
ARSSRPILDPSGRVQSYVAEGGAKDVRAAVEAAHQAAQGWAARCPADRAAALWALAAALE
RRQPGPGVKLEQPGARGQPAAAEVQRSVERLRTWGARAQDQGRALQIPGLRGLVLKLREP
LGVLVIVCPDDWPLLAFISLLAPAMAHGNAVVLVPSGTCPLPALEVCQDIATLFPAGLVN
VVTGDRDHLTRCLALHQDVQVLWYFGSPQGSQFVEWASAGNLKPVWVNGNCSRAWDLEGE
GSSQELGLRAARTKALWLPMGD
Download sequence
Identical sequences ENSDORP00000012786 ENSDORP00000012786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]