SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015189 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015189
Domain Number 1 Region: 358-415
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3e-23
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 2 Region: 303-359
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.83e-22
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 3 Region: 246-303
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.99e-16
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 4 Region: 208-260
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.06e-16
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 5 Region: 400-452
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.78e-16
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 6 Region: 129-180
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000114
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 7 Region: 9-55
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000124
Family KRAB domain (Kruppel-associated box) 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015189   Gene: ENSDORG00000016148   Transcript: ENSDORT00000016148
Sequence length 458
Comment pep:novel scaffold:dipOrd1:scaffold_13826:9278:12276:1 gene:ENSDORG00000016148 transcript:ENSDORT00000016148 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPEDLVPFDVAWHFTKREWLSLNPEQRMLAYYGNVTSIAGVPVLNPTLVSHLAQGQVLLV
SDSSLGTGQAKHSESTSVTHQLTMGKEGQPQETASTSYPRTSDPGAEVKQNGDLDGREGS
PPNLPIEHHFACKECGDTFRLKVLLVQHQSVHSEEKGWDCGDCGEVFRKVSEFNEHRKSH
VASQPRPGPSQALEDVIEKREQMEREAKPFACEECGKRFKKNAGLSQHLRVHSREKPFDC
EECGQSFKANTHLFQHQKLHTLEKPFACKACSRDFLDRQELLKHQRMHTGHLPFDCDDCG
KSFRGINGLAEHQRIHSGAKPYGCPHCGKLFRRSSELTKHRRIHTGEKPYECSECGKAFR
QSSSLLEHTRIHSGERPYVCGECGKAFRGPSDLIKHRRIHSGLKPYECDKCGKAFRRSSG
LSRHRRIHSGTRRCECSKCGRVFKRRSALQKHQPSHQE
Download sequence
Identical sequences ENSDORP00000015189 ENSDORP00000015189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]