SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015361 from Dipodomys ordii 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015361
Domain Number 1 Region: 192-419
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 3.63e-76
Family PDEase 0.0000112
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000015361
Domain Number - Region: 75-124
Classification Level Classification E-value
Superfamily dUTPase-like 0.0031
Family dUTPase-like 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015361   Gene: ENSDORG00000016323   Transcript: ENSDORT00000016324
Sequence length 442
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_462:57826:112187:-1 gene:ENSDORG00000016323 transcript:ENSDORT00000016324 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGITLIWCLALVLIKWITSKRRXVIMHDVRVRSRAGFESERRGSHPYIDFRIFHSQSEFE
VSVSARNIRRLLSFQRYLRSSRFFRGTTVSSSLNILDDDYNGQAKCMLEKVGNWNFDIFL
FDRLTNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXLANSVTPWDILLSLIAAATHDLDHPGVNQPFLIKTNHYLATLYKNTSV
LENHHWRSAVGLLRESGLFSHLPLESRQQMETQIGALILATDISRQNEYLSLFRSHLDRG
DLRLDDGRHRHLVLQMALKCADICNPCRTWELSKQWSEKVTEEFFHQGDIEKKYHLGVSP
LCDRQTESIANIQIGFMTYLVEPLFTEWARFSDTRLSQTMLGHVGLNKASWKGLQREQSS
SEDTDAAFELNSQLLPQENRLS
Download sequence
Identical sequences ENSDORP00000015361 ENSDORP00000015361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]