SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|310816995|ref|YP_003964959.1| from Ketogulonicigenium vulgare Y25

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310816995|ref|YP_003964959.1|
Domain Number 1 Region: 75-169
Classification Level Classification E-value
Superfamily Ribosomal protein L6 2.75e-37
Family Ribosomal protein L6 0.0000433
Further Details:      
 
Domain Number 2 Region: 2-74
Classification Level Classification E-value
Superfamily Ribosomal protein L6 1.23e-18
Family Ribosomal protein L6 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|310816995|ref|YP_003964959.1|
Sequence length 169
Comment 50S ribosomal protein L6 [Ketogulonicigenium vulgare Y25]
Sequence
MAIPAGVTATVSGQSIEIKGPKGTLNFKATDDVTLAVEDGAVTVTPRGLSKRARQQWGMS
RSMVENLITGVTKGFRKELEITGVGYRANLQGNVLKLSLGYSHDVNFEIPKDVTVTSPKQ
TEIVIEGIDAQRVGQVAANIREWKAPEPYKGKGIKYKGEFIFRKEGKKK
Download sequence
Identical sequences E3EZB8
gi|310816995|ref|YP_003964959.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]