SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|315504072|ref|YP_004082959.1| from Micromonospora sp. L5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|315504072|ref|YP_004082959.1|
Domain Number 1 Region: 20-226
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 0.0000142
Family Heme-dependent catalases 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|315504072|ref|YP_004082959.1|
Sequence length 237
Comment phosphodiesterase [Micromonospora sp. L5]
Sequence
MAATTPSVVERAAAALARLRHARLLHPAGRTFAGETRIWGTPGPPTGVPLLDLPGRWPAT
IRLSKGVPTPGGWPDVLGVAVRLHRDPEPPVDLLWSSSAAAPVLRNLPLPRRRFTGTYTS
IMPFRAGGRRLFLAVLADPESPDLGRGLAEAGAAVAGDEPRLVLAVASAVGRWRPFGEVR
LDDERGAAEDAALAFDPIGNVPPGLRLAGPLARLRDDSYRGSRRARGAGLSRAARRG
Download sequence
Identical sequences gi|315504072|ref|YP_004082959.1| WP_013475424.1.11406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]