SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|315501137|ref|YP_004080024.1| from Micromonospora sp. L5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|315501137|ref|YP_004080024.1|
Domain Number 1 Region: 10-324
Classification Level Classification E-value
Superfamily FMN-binding split barrel 8.24e-114
Family UbiD middle domain-like 0.0000000403
Further Details:      
 
Domain Number 2 Region: 325-488
Classification Level Classification E-value
Superfamily UbiD C-terminal domain-like 7.06e-57
Family UbiD C-terminal domain-like 0.0000316
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|315501137|ref|YP_004080024.1|
Sequence length 488
Comment ubid family decarboxylase [Micromonospora sp. L5]
Sequence
MGGMAARFPYTDLKDFLAALERAGELRRVSAPVDPTLEISEIVTRTVRAGGPALLFERPT
RGEMPVAINLFGTEKRMAMALGVEHLDEIGERIGDMLKPELPQGFSGMMGGLGKVMQLKS
MPPKKVKTAPCQQVVYRGDDVDLNRLPGLQVWPGDGGIFHNFGLTHTKHPETGKRNLGLY
RLQQHSHNTIGMHWQIHKNSTAHHAVAERLGQRLPVAIAIGADPVVAYSASAPLPADIDE
YLFAGFLAGERVEMVDCLTVPLQVPAHAQIVLEGYIEPGERLPEGPFGDHTGFYTPVEPF
PVMHIECMTMQRDPVYHSIVTSQPPQEDHGLGKATERIFAPLLRFLIPDIVDYDLPAAGV
FHNCAIVSIRKRYPKHAQKVMNAIWGAHMMSLTKLIVIVDEDCDVHDYNEVAFRAFGNVD
YARDLMVTEGPVDHLDHASYQQFWGGKAGIDATRKLPEEGYSRGWPEEMRMSPEVVSLVD
KRWKEYGI
Download sequence
Identical sequences A0A1C6TAD4
gi|315501137|ref|YP_004080024.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]