SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|310644421|ref|YP_003949180.1| from Paenibacillus polymyxa SC2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310644421|ref|YP_003949180.1|
Domain Number 1 Region: 6-174
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.58e-43
Family N-acetyl transferase, NAT 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|310644421|ref|YP_003949180.1|
Sequence length 182
Comment gcn5-like N-acetyltransferase [Paenibacillus polymyxa SC2]
Sequence
MFTYALDERTVLRPLTKEHVQPLFELIEMSRDRLRQWLPWVDSTTEISHTEQFVQGALKQ
AAENGSLTAGIWIDNELAGIISYHEINWAHRSVSIGYWLGHGYEGQGLMTSACRVFVEYA
LMELDLHRVEIRCATTNRRSRGIPERLGFVLEGIVREAELLPDGYMNHAVYGMLQNEWKQ
LR
Download sequence
Identical sequences A0A0F0G1E6 A0A165MVR3 E3E784
WP_013373475.1.13814 WP_013373475.1.14980 WP_013373475.1.15730 WP_013373475.1.16985 WP_013373475.1.21650 WP_013373475.1.29540 WP_013373475.1.30741 WP_013373475.1.31500 WP_013373475.1.36933 WP_013373475.1.40264 WP_013373475.1.41886 WP_013373475.1.57060 WP_013373475.1.6267 WP_013373475.1.71998 WP_013373475.1.78809 WP_013373475.1.88866 WP_013373475.1.91857 WP_013373475.1.99789 gi|310644421|ref|YP_003949180.1| gi|507717613|ref|YP_008050222.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]