SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16802957|ref|NP_464442.1| from Listeria monocytogenes EGD-e

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16802957|ref|NP_464442.1|
Domain Number 1 Region: 12-109
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 4.05e-27
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|16802957|ref|NP_464442.1|
Sequence length 116
Comment hypothetical protein lmo0916 [Listeria monocytogenes EGD-e]
Sequence
MSEQDYVEETDSLNELSMNILIHAGNARNDLVKGLNHLEELEFNEAEEFIASAKREIVIA
HSLQTDTLQLEASGNQIRYSTLFCHAQDTLMTAKSEILIGEHMLRLFKKMTELTKK
Download sequence
Identical sequences A0A1D2IWX8 A0A2G8PRS3 A0A2G8Q835 A0A2G8QGW8 A0A2G8QXU8 Q8Y8I6
gi|386046580|ref|YP_005964912.1| 169963.lmo0916 gi|284994389|ref|YP_003416157.1| gi|470209798|ref|YP_007606372.1| gi|405757915|ref|YP_006687191.1| gi|404283359|ref|YP_006684256.1| gi|16802957|ref|NP_464442.1| gi|284801247|ref|YP_003413112.1| gi|386049845|ref|YP_005967836.1| NP_464442.1.42710 WP_003721484.1.100045 WP_003721484.1.100147 WP_003721484.1.100229 WP_003721484.1.100510 WP_003721484.1.100530 WP_003721484.1.101144 WP_003721484.1.101354 WP_003721484.1.101752 WP_003721484.1.10186 WP_003721484.1.101945 WP_003721484.1.10198 WP_003721484.1.10484 WP_003721484.1.1123 WP_003721484.1.11266 WP_003721484.1.11313 WP_003721484.1.11326 WP_003721484.1.11419 WP_003721484.1.11686 WP_003721484.1.11712 WP_003721484.1.11738 WP_003721484.1.11779 WP_003721484.1.11851 WP_003721484.1.11940 WP_003721484.1.12037 WP_003721484.1.12143 WP_003721484.1.12824 WP_003721484.1.13052 WP_003721484.1.13134 WP_003721484.1.13160 WP_003721484.1.13304 WP_003721484.1.1336 WP_003721484.1.13695 WP_003721484.1.137 WP_003721484.1.13833 WP_003721484.1.1556 WP_003721484.1.1576 WP_003721484.1.15816 WP_003721484.1.16207 WP_003721484.1.16499 WP_003721484.1.1657 WP_003721484.1.16634 WP_003721484.1.17228 WP_003721484.1.17352 WP_003721484.1.17604 WP_003721484.1.1764 WP_003721484.1.17644 WP_003721484.1.17695 WP_003721484.1.178 WP_003721484.1.1794 WP_003721484.1.1803 WP_003721484.1.18576 WP_003721484.1.18648 WP_003721484.1.19080 WP_003721484.1.19189 WP_003721484.1.19409 WP_003721484.1.1947 WP_003721484.1.19548 WP_003721484.1.20402 WP_003721484.1.21705 WP_003721484.1.21884 WP_003721484.1.21926 WP_003721484.1.21995 WP_003721484.1.22154 WP_003721484.1.22190 WP_003721484.1.22202 WP_003721484.1.22434 WP_003721484.1.22962 WP_003721484.1.23193 WP_003721484.1.23254 WP_003721484.1.23582 WP_003721484.1.2368 WP_003721484.1.24349 WP_003721484.1.24370 WP_003721484.1.24546 WP_003721484.1.24651 WP_003721484.1.24818 WP_003721484.1.24836 WP_003721484.1.24945 WP_003721484.1.24972 WP_003721484.1.25020 WP_003721484.1.25057 WP_003721484.1.26052 WP_003721484.1.26060 WP_003721484.1.26103 WP_003721484.1.26145 WP_003721484.1.26320 WP_003721484.1.26350 WP_003721484.1.26406 WP_003721484.1.26523 WP_003721484.1.26632 WP_003721484.1.26891 WP_003721484.1.27200 WP_003721484.1.27231 WP_003721484.1.27281 WP_003721484.1.27839 WP_003721484.1.28123 WP_003721484.1.28297 WP_003721484.1.28325 WP_003721484.1.28402 WP_003721484.1.28747 WP_003721484.1.28803 WP_003721484.1.2920 WP_003721484.1.29550 WP_003721484.1.29723 WP_003721484.1.29738 WP_003721484.1.29872 WP_003721484.1.30193 WP_003721484.1.30227 WP_003721484.1.30267 WP_003721484.1.305 WP_003721484.1.30827 WP_003721484.1.30882 WP_003721484.1.30902 WP_003721484.1.31116 WP_003721484.1.31444 WP_003721484.1.31584 WP_003721484.1.31830 WP_003721484.1.32209 WP_003721484.1.32210 WP_003721484.1.32402 WP_003721484.1.32472 WP_003721484.1.32622 WP_003721484.1.3324 WP_003721484.1.33336 WP_003721484.1.337 WP_003721484.1.33875 WP_003721484.1.33995 WP_003721484.1.34326 WP_003721484.1.34851 WP_003721484.1.350 WP_003721484.1.35450 WP_003721484.1.36181 WP_003721484.1.364 WP_003721484.1.36599 WP_003721484.1.37278 WP_003721484.1.37518 WP_003721484.1.3782 WP_003721484.1.37882 WP_003721484.1.38025 WP_003721484.1.38150 WP_003721484.1.3853 WP_003721484.1.38733 WP_003721484.1.38792 WP_003721484.1.38800 WP_003721484.1.38833 WP_003721484.1.39115 WP_003721484.1.3919 WP_003721484.1.39262 WP_003721484.1.39351 WP_003721484.1.39554 WP_003721484.1.3959 WP_003721484.1.39887 WP_003721484.1.40263 WP_003721484.1.405 WP_003721484.1.40820 WP_003721484.1.40976 WP_003721484.1.41903 WP_003721484.1.41909 WP_003721484.1.42010 WP_003721484.1.4218 WP_003721484.1.42615 WP_003721484.1.42672 WP_003721484.1.43280 WP_003721484.1.43327 WP_003721484.1.43619 WP_003721484.1.4371 WP_003721484.1.44023 WP_003721484.1.4479 WP_003721484.1.44897 WP_003721484.1.44924 WP_003721484.1.45295 WP_003721484.1.45309 WP_003721484.1.45524 WP_003721484.1.45758 WP_003721484.1.45877 WP_003721484.1.45983 WP_003721484.1.45994 WP_003721484.1.4604 WP_003721484.1.46045 WP_003721484.1.46314 WP_003721484.1.46863 WP_003721484.1.46883 WP_003721484.1.47055 WP_003721484.1.47412 WP_003721484.1.47738 WP_003721484.1.48180 WP_003721484.1.48358 WP_003721484.1.48624 WP_003721484.1.48661 WP_003721484.1.48999 WP_003721484.1.49146 WP_003721484.1.49202 WP_003721484.1.49604 WP_003721484.1.49952 WP_003721484.1.49962 WP_003721484.1.5020 WP_003721484.1.50236 WP_003721484.1.50237 WP_003721484.1.50243 WP_003721484.1.50334 WP_003721484.1.50883 WP_003721484.1.50926 WP_003721484.1.50971 WP_003721484.1.51318 WP_003721484.1.51435 WP_003721484.1.51732 WP_003721484.1.52447 WP_003721484.1.52617 WP_003721484.1.52989 WP_003721484.1.53102 WP_003721484.1.53161 WP_003721484.1.5317 WP_003721484.1.53266 WP_003721484.1.53378 WP_003721484.1.53807 WP_003721484.1.54046 WP_003721484.1.54155 WP_003721484.1.54160 WP_003721484.1.54181 WP_003721484.1.54564 WP_003721484.1.54639 WP_003721484.1.54646 WP_003721484.1.55231 WP_003721484.1.55238 WP_003721484.1.55487 WP_003721484.1.55683 WP_003721484.1.55740 WP_003721484.1.55797 WP_003721484.1.5601 WP_003721484.1.56415 WP_003721484.1.56526 WP_003721484.1.56557 WP_003721484.1.56759 WP_003721484.1.56923 WP_003721484.1.57132 WP_003721484.1.57504 WP_003721484.1.57505 WP_003721484.1.57625 WP_003721484.1.57766 WP_003721484.1.57963 WP_003721484.1.57979 WP_003721484.1.58069 WP_003721484.1.58088 WP_003721484.1.58177 WP_003721484.1.58532 WP_003721484.1.58544 WP_003721484.1.59045 WP_003721484.1.59343 WP_003721484.1.59571 WP_003721484.1.5973 WP_003721484.1.59799 WP_003721484.1.59949 WP_003721484.1.59984 WP_003721484.1.60166 WP_003721484.1.60191 WP_003721484.1.60219 WP_003721484.1.60258 WP_003721484.1.60369 WP_003721484.1.60956 WP_003721484.1.61002 WP_003721484.1.61109 WP_003721484.1.61244 WP_003721484.1.62430 WP_003721484.1.62629 WP_003721484.1.62663 WP_003721484.1.62852 WP_003721484.1.62904 WP_003721484.1.62972 WP_003721484.1.63359 WP_003721484.1.63676 WP_003721484.1.63951 WP_003721484.1.6397 WP_003721484.1.64041 WP_003721484.1.64200 WP_003721484.1.64227 WP_003721484.1.64259 WP_003721484.1.6460 WP_003721484.1.648 WP_003721484.1.65094 WP_003721484.1.65213 WP_003721484.1.65376 WP_003721484.1.65730 WP_003721484.1.65827 WP_003721484.1.65840 WP_003721484.1.65913 WP_003721484.1.66005 WP_003721484.1.66039 WP_003721484.1.66184 WP_003721484.1.66311 WP_003721484.1.66338 WP_003721484.1.66512 WP_003721484.1.66884 WP_003721484.1.66903 WP_003721484.1.67165 WP_003721484.1.67301 WP_003721484.1.67408 WP_003721484.1.67610 WP_003721484.1.67709 WP_003721484.1.67795 WP_003721484.1.67884 WP_003721484.1.68112 WP_003721484.1.68123 WP_003721484.1.68301 WP_003721484.1.68321 WP_003721484.1.68528 WP_003721484.1.69471 WP_003721484.1.69570 WP_003721484.1.69631 WP_003721484.1.70309 WP_003721484.1.7051 WP_003721484.1.70690 WP_003721484.1.70992 WP_003721484.1.71468 WP_003721484.1.71753 WP_003721484.1.71921 WP_003721484.1.72051 WP_003721484.1.72057 WP_003721484.1.72228 WP_003721484.1.72566 WP_003721484.1.72636 WP_003721484.1.734 WP_003721484.1.73656 WP_003721484.1.73769 WP_003721484.1.74217 WP_003721484.1.74351 WP_003721484.1.74450 WP_003721484.1.7454 WP_003721484.1.74572 WP_003721484.1.74754 WP_003721484.1.74837 WP_003721484.1.75069 WP_003721484.1.75240 WP_003721484.1.75541 WP_003721484.1.75604 WP_003721484.1.75624 WP_003721484.1.75670 WP_003721484.1.76124 WP_003721484.1.76769 WP_003721484.1.77116 WP_003721484.1.77149 WP_003721484.1.77246 WP_003721484.1.77350 WP_003721484.1.7736 WP_003721484.1.77376 WP_003721484.1.77420 WP_003721484.1.77681 WP_003721484.1.77823 WP_003721484.1.78121 WP_003721484.1.78167 WP_003721484.1.78203 WP_003721484.1.7832 WP_003721484.1.78336 WP_003721484.1.78525 WP_003721484.1.79184 WP_003721484.1.79212 WP_003721484.1.7932 WP_003721484.1.79351 WP_003721484.1.79434 WP_003721484.1.79458 WP_003721484.1.79630 WP_003721484.1.79803 WP_003721484.1.79964 WP_003721484.1.80028 WP_003721484.1.80036 WP_003721484.1.80105 WP_003721484.1.80790 WP_003721484.1.81261 WP_003721484.1.81503 WP_003721484.1.81662 WP_003721484.1.81713 WP_003721484.1.82274 WP_003721484.1.82440 WP_003721484.1.82667 WP_003721484.1.82719 WP_003721484.1.82893 WP_003721484.1.83030 WP_003721484.1.83121 WP_003721484.1.83137 WP_003721484.1.83215 WP_003721484.1.83260 WP_003721484.1.83323 WP_003721484.1.83350 WP_003721484.1.83478 WP_003721484.1.83542 WP_003721484.1.83546 WP_003721484.1.83932 WP_003721484.1.8418 WP_003721484.1.84320 WP_003721484.1.84539 WP_003721484.1.84579 WP_003721484.1.84586 WP_003721484.1.84781 WP_003721484.1.84833 WP_003721484.1.84980 WP_003721484.1.85037 WP_003721484.1.85203 WP_003721484.1.8593 WP_003721484.1.86091 WP_003721484.1.86253 WP_003721484.1.86308 WP_003721484.1.86484 WP_003721484.1.86597 WP_003721484.1.87085 WP_003721484.1.8710 WP_003721484.1.87108 WP_003721484.1.87536 WP_003721484.1.87701 WP_003721484.1.87794 WP_003721484.1.8782 WP_003721484.1.87920 WP_003721484.1.88015 WP_003721484.1.88063 WP_003721484.1.88112 WP_003721484.1.88128 WP_003721484.1.88485 WP_003721484.1.88584 WP_003721484.1.8884 WP_003721484.1.89085 WP_003721484.1.89160 WP_003721484.1.8932 WP_003721484.1.89386 WP_003721484.1.89450 WP_003721484.1.89809 WP_003721484.1.8988 WP_003721484.1.90086 WP_003721484.1.9019 WP_003721484.1.90201 WP_003721484.1.90821 WP_003721484.1.90829 WP_003721484.1.9109 WP_003721484.1.91168 WP_003721484.1.91514 WP_003721484.1.91556 WP_003721484.1.91765 WP_003721484.1.92132 WP_003721484.1.92148 WP_003721484.1.92274 WP_003721484.1.92409 WP_003721484.1.93556 WP_003721484.1.93777 WP_003721484.1.93859 WP_003721484.1.93895 WP_003721484.1.93920 WP_003721484.1.94032 WP_003721484.1.94758 WP_003721484.1.94961 WP_003721484.1.95162 WP_003721484.1.95186 WP_003721484.1.95702 WP_003721484.1.95945 WP_003721484.1.96033 WP_003721484.1.96140 WP_003721484.1.96296 WP_003721484.1.96586 WP_003721484.1.9672 WP_003721484.1.96874 WP_003721484.1.96940 WP_003721484.1.97165 WP_003721484.1.97199 WP_003721484.1.97203 WP_003721484.1.97390 WP_003721484.1.97820 WP_003721484.1.98038 WP_003721484.1.98193 WP_003721484.1.98331 WP_003721484.1.98866 WP_003721484.1.9894 WP_003721484.1.99026 WP_003721484.1.9916 WP_003721484.1.99357 WP_003721484.1.99480 WP_003721484.1.99512 WP_003721484.1.99520 WP_003721484.1.99785 WP_003721484.1.99786 WP_003721484.1.99974 gi|404413002|ref|YP_006698589.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]