SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16803759|ref|NP_465244.1| from Listeria monocytogenes EGD-e

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16803759|ref|NP_465244.1|
Domain Number 1 Region: 1-98
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 9.68e-38
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|16803759|ref|NP_465244.1|
Sequence length 100
Comment hypothetical protein lmo1719 [Listeria monocytogenes EGD-e]
Sequence
MELEQTIMQLIVHGGNAKSDAMLAIEAAKKGDFDVADEQIKNAEAALLEAHHSQTSLIQG
EARGEKAEVSLLLVHAQDHLMNAITFKDLAKEIVDLYRSK
Download sequence
Identical sequences A0A0H3GCS3 A0A1D2IUF8 A0A2G8PSQ3 A0A2G8Q3P0 A0A2G8QIQ5 A0A2G8QQU6 A0A2G8R3M3 A0AJH2 H1G7S7 Q7ANY1 Q92AT9
gi|386050696|ref|YP_005968687.1| gi|116873152|ref|YP_849933.1| gi|470210683|ref|YP_007607257.1| gi|386047371|ref|YP_005965703.1| gi|284802163|ref|YP_003414028.1| gi|405758770|ref|YP_006688046.1| gi|404284215|ref|YP_006685112.1| NP_465244.1.42710 WP_003722196.1.100045 WP_003722196.1.100112 WP_003722196.1.100147 WP_003722196.1.100229 WP_003722196.1.100510 WP_003722196.1.100530 WP_003722196.1.10112 WP_003722196.1.101144 WP_003722196.1.101184 WP_003722196.1.101252 WP_003722196.1.101354 WP_003722196.1.101368 WP_003722196.1.101752 WP_003722196.1.10186 WP_003722196.1.101945 WP_003722196.1.10198 WP_003722196.1.10420 WP_003722196.1.10484 WP_003722196.1.11177 WP_003722196.1.1123 WP_003722196.1.11266 WP_003722196.1.11313 WP_003722196.1.11419 WP_003722196.1.11686 WP_003722196.1.11712 WP_003722196.1.11738 WP_003722196.1.11779 WP_003722196.1.11851 WP_003722196.1.11907 WP_003722196.1.11940 WP_003722196.1.11973 WP_003722196.1.11976 WP_003722196.1.12037 WP_003722196.1.12143 WP_003722196.1.12377 WP_003722196.1.12824 WP_003722196.1.12988 WP_003722196.1.13052 WP_003722196.1.13105 WP_003722196.1.13134 WP_003722196.1.13160 WP_003722196.1.13304 WP_003722196.1.1336 WP_003722196.1.13428 WP_003722196.1.13695 WP_003722196.1.137 WP_003722196.1.13833 WP_003722196.1.1556 WP_003722196.1.1576 WP_003722196.1.15816 WP_003722196.1.16207 WP_003722196.1.16499 WP_003722196.1.1657 WP_003722196.1.16634 WP_003722196.1.17228 WP_003722196.1.17352 WP_003722196.1.17375 WP_003722196.1.17604 WP_003722196.1.1764 WP_003722196.1.17644 WP_003722196.1.17695 WP_003722196.1.178 WP_003722196.1.1794 WP_003722196.1.17947 WP_003722196.1.1803 WP_003722196.1.18222 WP_003722196.1.18576 WP_003722196.1.18648 WP_003722196.1.18689 WP_003722196.1.18979 WP_003722196.1.19080 WP_003722196.1.19189 WP_003722196.1.19371 WP_003722196.1.19409 WP_003722196.1.1947 WP_003722196.1.19548 WP_003722196.1.20402 WP_003722196.1.20416 WP_003722196.1.21046 WP_003722196.1.21133 WP_003722196.1.21705 WP_003722196.1.21884 WP_003722196.1.21926 WP_003722196.1.21995 WP_003722196.1.22154 WP_003722196.1.22190 WP_003722196.1.22202 WP_003722196.1.22434 WP_003722196.1.22656 WP_003722196.1.22962 WP_003722196.1.23193 WP_003722196.1.23254 WP_003722196.1.2340 WP_003722196.1.23582 WP_003722196.1.23624 WP_003722196.1.2368 WP_003722196.1.2422 WP_003722196.1.24349 WP_003722196.1.24370 WP_003722196.1.24546 WP_003722196.1.24651 WP_003722196.1.24818 WP_003722196.1.24836 WP_003722196.1.24945 WP_003722196.1.24972 WP_003722196.1.25020 WP_003722196.1.25057 WP_003722196.1.25401 WP_003722196.1.26052 WP_003722196.1.26060 WP_003722196.1.26103 WP_003722196.1.26139 WP_003722196.1.26145 WP_003722196.1.26146 WP_003722196.1.26320 WP_003722196.1.26350 WP_003722196.1.26406 WP_003722196.1.26523 WP_003722196.1.26632 WP_003722196.1.26891 WP_003722196.1.27200 WP_003722196.1.27231 WP_003722196.1.27281 WP_003722196.1.27839 WP_003722196.1.28042 WP_003722196.1.28062 WP_003722196.1.28123 WP_003722196.1.28297 WP_003722196.1.28325 WP_003722196.1.28402 WP_003722196.1.28747 WP_003722196.1.28803 WP_003722196.1.2920 WP_003722196.1.29331 WP_003722196.1.29550 WP_003722196.1.29705 WP_003722196.1.29723 WP_003722196.1.29738 WP_003722196.1.29762 WP_003722196.1.29872 WP_003722196.1.29912 WP_003722196.1.30193 WP_003722196.1.30227 WP_003722196.1.30267 WP_003722196.1.305 WP_003722196.1.30827 WP_003722196.1.30882 WP_003722196.1.30902 WP_003722196.1.31108 WP_003722196.1.31116 WP_003722196.1.31444 WP_003722196.1.31485 WP_003722196.1.31584 WP_003722196.1.31830 WP_003722196.1.32209 WP_003722196.1.32210 WP_003722196.1.32278 WP_003722196.1.32402 WP_003722196.1.32472 WP_003722196.1.32622 WP_003722196.1.3324 WP_003722196.1.33336 WP_003722196.1.33688 WP_003722196.1.337 WP_003722196.1.33875 WP_003722196.1.33995 WP_003722196.1.34326 WP_003722196.1.34732 WP_003722196.1.34849 WP_003722196.1.34851 WP_003722196.1.350 WP_003722196.1.35135 WP_003722196.1.35402 WP_003722196.1.35450 WP_003722196.1.36181 WP_003722196.1.36203 WP_003722196.1.36241 WP_003722196.1.364 WP_003722196.1.36599 WP_003722196.1.36877 WP_003722196.1.36936 WP_003722196.1.37278 WP_003722196.1.37561 WP_003722196.1.3782 WP_003722196.1.37882 WP_003722196.1.38025 WP_003722196.1.38076 WP_003722196.1.38150 WP_003722196.1.38224 WP_003722196.1.38471 WP_003722196.1.3853 WP_003722196.1.38733 WP_003722196.1.38792 WP_003722196.1.38800 WP_003722196.1.38833 WP_003722196.1.39115 WP_003722196.1.3919 WP_003722196.1.39262 WP_003722196.1.39351 WP_003722196.1.39554 WP_003722196.1.3959 WP_003722196.1.39630 WP_003722196.1.39887 WP_003722196.1.40124 WP_003722196.1.40263 WP_003722196.1.405 WP_003722196.1.40720 WP_003722196.1.40820 WP_003722196.1.40953 WP_003722196.1.40976 WP_003722196.1.41281 WP_003722196.1.41348 WP_003722196.1.41903 WP_003722196.1.41909 WP_003722196.1.41955 WP_003722196.1.42010 WP_003722196.1.42127 WP_003722196.1.4218 WP_003722196.1.42615 WP_003722196.1.42672 WP_003722196.1.42958 WP_003722196.1.43267 WP_003722196.1.43280 WP_003722196.1.43327 WP_003722196.1.43619 WP_003722196.1.4371 WP_003722196.1.44023 WP_003722196.1.44106 WP_003722196.1.44645 WP_003722196.1.4479 WP_003722196.1.44897 WP_003722196.1.44924 WP_003722196.1.45295 WP_003722196.1.45309 WP_003722196.1.45524 WP_003722196.1.45708 WP_003722196.1.45758 WP_003722196.1.45811 WP_003722196.1.45877 WP_003722196.1.45983 WP_003722196.1.45994 WP_003722196.1.4604 WP_003722196.1.46045 WP_003722196.1.4615 WP_003722196.1.46314 WP_003722196.1.46653 WP_003722196.1.46863 WP_003722196.1.46883 WP_003722196.1.47055 WP_003722196.1.47412 WP_003722196.1.47593 WP_003722196.1.4766 WP_003722196.1.47738 WP_003722196.1.47953 WP_003722196.1.48180 WP_003722196.1.48358 WP_003722196.1.48435 WP_003722196.1.48471 WP_003722196.1.48572 WP_003722196.1.48624 WP_003722196.1.48661 WP_003722196.1.48999 WP_003722196.1.49146 WP_003722196.1.49202 WP_003722196.1.49205 WP_003722196.1.49415 WP_003722196.1.49467 WP_003722196.1.49604 WP_003722196.1.49668 WP_003722196.1.49952 WP_003722196.1.49962 WP_003722196.1.5020 WP_003722196.1.50236 WP_003722196.1.50237 WP_003722196.1.50243 WP_003722196.1.50334 WP_003722196.1.50883 WP_003722196.1.50888 WP_003722196.1.50898 WP_003722196.1.50926 WP_003722196.1.50971 WP_003722196.1.5129 WP_003722196.1.51318 WP_003722196.1.51435 WP_003722196.1.51510 WP_003722196.1.51650 WP_003722196.1.51720 WP_003722196.1.51732 WP_003722196.1.5175 WP_003722196.1.52177 WP_003722196.1.52395 WP_003722196.1.52447 WP_003722196.1.52617 WP_003722196.1.52684 WP_003722196.1.52867 WP_003722196.1.52989 WP_003722196.1.53102 WP_003722196.1.53161 WP_003722196.1.5317 WP_003722196.1.53266 WP_003722196.1.53378 WP_003722196.1.53807 WP_003722196.1.53920 WP_003722196.1.54046 WP_003722196.1.54155 WP_003722196.1.54160 WP_003722196.1.5417 WP_003722196.1.54181 WP_003722196.1.54564 WP_003722196.1.54639 WP_003722196.1.54646 WP_003722196.1.54890 WP_003722196.1.55231 WP_003722196.1.55238 WP_003722196.1.55487 WP_003722196.1.55683 WP_003722196.1.55740 WP_003722196.1.55797 WP_003722196.1.55824 WP_003722196.1.55847 WP_003722196.1.55890 WP_003722196.1.5601 WP_003722196.1.56269 WP_003722196.1.56415 WP_003722196.1.56526 WP_003722196.1.56557 WP_003722196.1.56759 WP_003722196.1.56923 WP_003722196.1.57132 WP_003722196.1.57171 WP_003722196.1.57404 WP_003722196.1.57504 WP_003722196.1.57505 WP_003722196.1.57547 WP_003722196.1.57578 WP_003722196.1.57625 WP_003722196.1.57766 WP_003722196.1.57948 WP_003722196.1.57963 WP_003722196.1.57979 WP_003722196.1.58030 WP_003722196.1.58069 WP_003722196.1.58088 WP_003722196.1.58177 WP_003722196.1.58532 WP_003722196.1.58544 WP_003722196.1.58661 WP_003722196.1.58828 WP_003722196.1.59045 WP_003722196.1.59343 WP_003722196.1.59477 WP_003722196.1.59571 WP_003722196.1.5973 WP_003722196.1.59799 WP_003722196.1.59937 WP_003722196.1.59949 WP_003722196.1.59984 WP_003722196.1.60166 WP_003722196.1.60191 WP_003722196.1.60219 WP_003722196.1.60258 WP_003722196.1.60346 WP_003722196.1.60369 WP_003722196.1.60665 WP_003722196.1.60956 WP_003722196.1.61002 WP_003722196.1.61109 WP_003722196.1.61244 WP_003722196.1.61894 WP_003722196.1.62177 WP_003722196.1.62430 WP_003722196.1.62629 WP_003722196.1.62655 WP_003722196.1.62663 WP_003722196.1.62852 WP_003722196.1.62904 WP_003722196.1.62972 WP_003722196.1.63359 WP_003722196.1.63676 WP_003722196.1.63932 WP_003722196.1.63951 WP_003722196.1.6397 WP_003722196.1.64041 WP_003722196.1.64200 WP_003722196.1.64227 WP_003722196.1.64259 WP_003722196.1.6460 WP_003722196.1.648 WP_003722196.1.65094 WP_003722196.1.65213 WP_003722196.1.65309 WP_003722196.1.65376 WP_003722196.1.65730 WP_003722196.1.6579 WP_003722196.1.65827 WP_003722196.1.65840 WP_003722196.1.65913 WP_003722196.1.66005 WP_003722196.1.66039 WP_003722196.1.66184 WP_003722196.1.66311 WP_003722196.1.66338 WP_003722196.1.66512 WP_003722196.1.6672 WP_003722196.1.66884 WP_003722196.1.66903 WP_003722196.1.67165 WP_003722196.1.67301 WP_003722196.1.6731 WP_003722196.1.67352 WP_003722196.1.67408 WP_003722196.1.67429 WP_003722196.1.67610 WP_003722196.1.6763 WP_003722196.1.67668 WP_003722196.1.67694 WP_003722196.1.67709 WP_003722196.1.67795 WP_003722196.1.67884 WP_003722196.1.68112 WP_003722196.1.68123 WP_003722196.1.68197 WP_003722196.1.68301 WP_003722196.1.68321 WP_003722196.1.68414 WP_003722196.1.68528 WP_003722196.1.69190 WP_003722196.1.69265 WP_003722196.1.69471 WP_003722196.1.69570 WP_003722196.1.69579 WP_003722196.1.69631 WP_003722196.1.6982 WP_003722196.1.70104 WP_003722196.1.70309 WP_003722196.1.7051 WP_003722196.1.70588 WP_003722196.1.70690 WP_003722196.1.70992 WP_003722196.1.71468 WP_003722196.1.71753 WP_003722196.1.71921 WP_003722196.1.72051 WP_003722196.1.72057 WP_003722196.1.72116 WP_003722196.1.7218 WP_003722196.1.72228 WP_003722196.1.72385 WP_003722196.1.72467 WP_003722196.1.72566 WP_003722196.1.72636 WP_003722196.1.72841 WP_003722196.1.734 WP_003722196.1.73656 WP_003722196.1.73769 WP_003722196.1.74217 WP_003722196.1.74290 WP_003722196.1.74351 WP_003722196.1.74450 WP_003722196.1.7454 WP_003722196.1.74572 WP_003722196.1.74754 WP_003722196.1.74837 WP_003722196.1.7498 WP_003722196.1.75069 WP_003722196.1.75240 WP_003722196.1.75541 WP_003722196.1.75604 WP_003722196.1.75624 WP_003722196.1.75670 WP_003722196.1.76124 WP_003722196.1.76769 WP_003722196.1.77116 WP_003722196.1.77149 WP_003722196.1.77192 WP_003722196.1.77246 WP_003722196.1.77350 WP_003722196.1.7736 WP_003722196.1.77376 WP_003722196.1.77420 WP_003722196.1.77681 WP_003722196.1.77823 WP_003722196.1.78121 WP_003722196.1.78167 WP_003722196.1.78203 WP_003722196.1.7832 WP_003722196.1.78336 WP_003722196.1.78525 WP_003722196.1.79184 WP_003722196.1.79212 WP_003722196.1.7932 WP_003722196.1.79351 WP_003722196.1.79434 WP_003722196.1.79458 WP_003722196.1.79630 WP_003722196.1.79803 WP_003722196.1.79964 WP_003722196.1.80028 WP_003722196.1.80036 WP_003722196.1.80105 WP_003722196.1.80790 WP_003722196.1.81261 WP_003722196.1.81503 WP_003722196.1.81662 WP_003722196.1.81713 WP_003722196.1.82274 WP_003722196.1.82440 WP_003722196.1.82667 WP_003722196.1.82719 WP_003722196.1.82893 WP_003722196.1.82951 WP_003722196.1.83030 WP_003722196.1.83121 WP_003722196.1.83137 WP_003722196.1.83215 WP_003722196.1.83260 WP_003722196.1.83323 WP_003722196.1.83350 WP_003722196.1.83478 WP_003722196.1.83542 WP_003722196.1.83546 WP_003722196.1.83607 WP_003722196.1.83932 WP_003722196.1.8418 WP_003722196.1.84265 WP_003722196.1.84320 WP_003722196.1.84367 WP_003722196.1.84539 WP_003722196.1.84579 WP_003722196.1.84586 WP_003722196.1.84588 WP_003722196.1.8460 WP_003722196.1.8473 WP_003722196.1.84781 WP_003722196.1.84833 WP_003722196.1.84980 WP_003722196.1.85037 WP_003722196.1.85203 WP_003722196.1.8593 WP_003722196.1.86091 WP_003722196.1.86253 WP_003722196.1.86308 WP_003722196.1.86484 WP_003722196.1.86597 WP_003722196.1.866 WP_003722196.1.86958 WP_003722196.1.87085 WP_003722196.1.8710 WP_003722196.1.87108 WP_003722196.1.87154 WP_003722196.1.87536 WP_003722196.1.87701 WP_003722196.1.87794 WP_003722196.1.8782 WP_003722196.1.87920 WP_003722196.1.88015 WP_003722196.1.88063 WP_003722196.1.88112 WP_003722196.1.88128 WP_003722196.1.88485 WP_003722196.1.88584 WP_003722196.1.88589 WP_003722196.1.8884 WP_003722196.1.88890 WP_003722196.1.89085 WP_003722196.1.89160 WP_003722196.1.8932 WP_003722196.1.89386 WP_003722196.1.89443 WP_003722196.1.89450 WP_003722196.1.89478 WP_003722196.1.89809 WP_003722196.1.8988 WP_003722196.1.90086 WP_003722196.1.9019 WP_003722196.1.90201 WP_003722196.1.90567 WP_003722196.1.90821 WP_003722196.1.90829 WP_003722196.1.9109 WP_003722196.1.91168 WP_003722196.1.91514 WP_003722196.1.91556 WP_003722196.1.91765 WP_003722196.1.92049 WP_003722196.1.92132 WP_003722196.1.92142 WP_003722196.1.92148 WP_003722196.1.92274 WP_003722196.1.92370 WP_003722196.1.92409 WP_003722196.1.92548 WP_003722196.1.92595 WP_003722196.1.93556 WP_003722196.1.93777 WP_003722196.1.93859 WP_003722196.1.93895 WP_003722196.1.93920 WP_003722196.1.93997 WP_003722196.1.94032 WP_003722196.1.94058 WP_003722196.1.94191 WP_003722196.1.94758 WP_003722196.1.94961 WP_003722196.1.95162 WP_003722196.1.95186 WP_003722196.1.95702 WP_003722196.1.95715 WP_003722196.1.95945 WP_003722196.1.96033 WP_003722196.1.96140 WP_003722196.1.96296 WP_003722196.1.96407 WP_003722196.1.9643 WP_003722196.1.96586 WP_003722196.1.9672 WP_003722196.1.96874 WP_003722196.1.96940 WP_003722196.1.97165 WP_003722196.1.97199 WP_003722196.1.97203 WP_003722196.1.9732 WP_003722196.1.97390 WP_003722196.1.97633 WP_003722196.1.97752 WP_003722196.1.97820 WP_003722196.1.98038 WP_003722196.1.98042 WP_003722196.1.98060 WP_003722196.1.98193 WP_003722196.1.98331 WP_003722196.1.98351 WP_003722196.1.98866 WP_003722196.1.9894 WP_003722196.1.99026 WP_003722196.1.9916 WP_003722196.1.99357 WP_003722196.1.99409 WP_003722196.1.99480 WP_003722196.1.99512 WP_003722196.1.99520 WP_003722196.1.99521 WP_003722196.1.99527 WP_003722196.1.99785 WP_003722196.1.99786 WP_003722196.1.99914 WP_003722196.1.99921 WP_003722196.1.99974 gi|386053972|ref|YP_005971530.1| gi|284995305|ref|YP_003417073.1| gi|386044027|ref|YP_005962832.1| gi|404411019|ref|YP_006696607.1| gi|470207546|ref|YP_007604121.1| gi|16803759|ref|NP_465244.1| 169963.lmo1719 272626.lin1830 386043.lwe1736 gi|404413797|ref|YP_006699384.1| gi|16800897|ref|NP_471165.1| gi|550897943|ref|YP_008667439.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]