SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|16804298|ref|NP_465783.1| from Listeria monocytogenes EGD-e

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|16804298|ref|NP_465783.1|
Domain Number 1 Region: 2-100
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 9.55e-28
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|16804298|ref|NP_465783.1|
Sequence length 116
Comment hypothetical protein lmo2259 [Listeria monocytogenes EGD-e]
Sequence
MEIQVEEAVVKLILHGGNTRKEAYKAIDFAEKYQFDEADKHLQIAQDQFQEGHIWQTKLV
SIRDSETVAHPSFLLIHGQDHLMTAQAELQLAKRIIEQYKHQQRLEERLTKLENQA
Download sequence
Identical sequences A0A1D2J093 A0A2G8QCQ0 A0A2G8QFX4 A0A2G8R066 Q8Y519
NP_465783.1.42710 WP_009913680.1.100229 WP_009913680.1.100510 WP_009913680.1.100530 WP_009913680.1.101354 WP_009913680.1.10186 WP_009913680.1.11177 WP_009913680.1.11266 WP_009913680.1.11313 WP_009913680.1.11326 WP_009913680.1.11686 WP_009913680.1.11712 WP_009913680.1.11779 WP_009913680.1.11851 WP_009913680.1.12037 WP_009913680.1.12143 WP_009913680.1.12377 WP_009913680.1.12824 WP_009913680.1.13160 WP_009913680.1.13304 WP_009913680.1.13695 WP_009913680.1.137 WP_009913680.1.1576 WP_009913680.1.16207 WP_009913680.1.16499 WP_009913680.1.1657 WP_009913680.1.17228 WP_009913680.1.17695 WP_009913680.1.178 WP_009913680.1.18576 WP_009913680.1.18648 WP_009913680.1.18979 WP_009913680.1.19080 WP_009913680.1.19371 WP_009913680.1.19409 WP_009913680.1.1947 WP_009913680.1.20416 WP_009913680.1.21046 WP_009913680.1.21133 WP_009913680.1.21705 WP_009913680.1.21926 WP_009913680.1.22154 WP_009913680.1.22434 WP_009913680.1.22656 WP_009913680.1.23193 WP_009913680.1.23254 WP_009913680.1.2340 WP_009913680.1.23582 WP_009913680.1.23624 WP_009913680.1.2368 WP_009913680.1.24370 WP_009913680.1.24818 WP_009913680.1.24972 WP_009913680.1.25020 WP_009913680.1.26052 WP_009913680.1.26145 WP_009913680.1.26146 WP_009913680.1.26350 WP_009913680.1.26406 WP_009913680.1.26632 WP_009913680.1.26891 WP_009913680.1.27281 WP_009913680.1.28402 WP_009913680.1.28747 WP_009913680.1.28803 WP_009913680.1.2920 WP_009913680.1.29331 WP_009913680.1.29550 WP_009913680.1.29738 WP_009913680.1.30193 WP_009913680.1.30227 WP_009913680.1.30267 WP_009913680.1.305 WP_009913680.1.31108 WP_009913680.1.31116 WP_009913680.1.31444 WP_009913680.1.31584 WP_009913680.1.31830 WP_009913680.1.32210 WP_009913680.1.32402 WP_009913680.1.32622 WP_009913680.1.3324 WP_009913680.1.33336 WP_009913680.1.33875 WP_009913680.1.33995 WP_009913680.1.34851 WP_009913680.1.35402 WP_009913680.1.35450 WP_009913680.1.36181 WP_009913680.1.364 WP_009913680.1.37518 WP_009913680.1.38076 WP_009913680.1.38471 WP_009913680.1.3853 WP_009913680.1.38833 WP_009913680.1.39115 WP_009913680.1.3919 WP_009913680.1.3959 WP_009913680.1.39887 WP_009913680.1.40820 WP_009913680.1.41281 WP_009913680.1.41903 WP_009913680.1.41955 WP_009913680.1.42010 WP_009913680.1.4218 WP_009913680.1.42672 WP_009913680.1.42958 WP_009913680.1.43619 WP_009913680.1.4371 WP_009913680.1.44023 WP_009913680.1.4479 WP_009913680.1.44924 WP_009913680.1.45309 WP_009913680.1.45758 WP_009913680.1.45983 WP_009913680.1.45994 WP_009913680.1.4604 WP_009913680.1.46863 WP_009913680.1.47055 WP_009913680.1.47412 WP_009913680.1.48180 WP_009913680.1.48358 WP_009913680.1.48435 WP_009913680.1.48471 WP_009913680.1.48661 WP_009913680.1.48999 WP_009913680.1.49146 WP_009913680.1.49202 WP_009913680.1.49604 WP_009913680.1.49952 WP_009913680.1.49962 WP_009913680.1.5020 WP_009913680.1.50236 WP_009913680.1.50334 WP_009913680.1.50883 WP_009913680.1.51318 WP_009913680.1.51732 WP_009913680.1.5175 WP_009913680.1.52447 WP_009913680.1.52684 WP_009913680.1.52867 WP_009913680.1.52989 WP_009913680.1.5317 WP_009913680.1.53266 WP_009913680.1.53378 WP_009913680.1.54160 WP_009913680.1.54564 WP_009913680.1.54639 WP_009913680.1.54646 WP_009913680.1.54890 WP_009913680.1.55238 WP_009913680.1.55487 WP_009913680.1.55683 WP_009913680.1.55740 WP_009913680.1.55797 WP_009913680.1.5601 WP_009913680.1.56526 WP_009913680.1.56759 WP_009913680.1.57625 WP_009913680.1.57766 WP_009913680.1.57963 WP_009913680.1.58069 WP_009913680.1.58088 WP_009913680.1.58177 WP_009913680.1.58544 WP_009913680.1.58661 WP_009913680.1.59045 WP_009913680.1.59343 WP_009913680.1.5973 WP_009913680.1.59799 WP_009913680.1.59937 WP_009913680.1.59949 WP_009913680.1.60166 WP_009913680.1.60191 WP_009913680.1.60219 WP_009913680.1.60369 WP_009913680.1.61244 WP_009913680.1.61894 WP_009913680.1.62663 WP_009913680.1.62972 WP_009913680.1.63359 WP_009913680.1.63951 WP_009913680.1.6397 WP_009913680.1.64041 WP_009913680.1.64200 WP_009913680.1.64227 WP_009913680.1.64259 WP_009913680.1.6460 WP_009913680.1.648 WP_009913680.1.65376 WP_009913680.1.6579 WP_009913680.1.66005 WP_009913680.1.66039 WP_009913680.1.66311 WP_009913680.1.66338 WP_009913680.1.66512 WP_009913680.1.66884 WP_009913680.1.66903 WP_009913680.1.67301 WP_009913680.1.67709 WP_009913680.1.68112 WP_009913680.1.68123 WP_009913680.1.68197 WP_009913680.1.68301 WP_009913680.1.68414 WP_009913680.1.69471 WP_009913680.1.69570 WP_009913680.1.69631 WP_009913680.1.6982 WP_009913680.1.7051 WP_009913680.1.70690 WP_009913680.1.70992 WP_009913680.1.71468 WP_009913680.1.72051 WP_009913680.1.72116 WP_009913680.1.72566 WP_009913680.1.72636 WP_009913680.1.734 WP_009913680.1.73769 WP_009913680.1.74217 WP_009913680.1.74290 WP_009913680.1.74450 WP_009913680.1.74572 WP_009913680.1.74754 WP_009913680.1.75240 WP_009913680.1.75541 WP_009913680.1.75670 WP_009913680.1.77420 WP_009913680.1.77681 WP_009913680.1.77823 WP_009913680.1.78167 WP_009913680.1.78336 WP_009913680.1.79184 WP_009913680.1.79212 WP_009913680.1.79630 WP_009913680.1.79964 WP_009913680.1.80036 WP_009913680.1.80105 WP_009913680.1.81261 WP_009913680.1.81713 WP_009913680.1.82274 WP_009913680.1.82440 WP_009913680.1.82667 WP_009913680.1.82893 WP_009913680.1.83030 WP_009913680.1.83137 WP_009913680.1.83215 WP_009913680.1.83260 WP_009913680.1.83350 WP_009913680.1.83478 WP_009913680.1.83546 WP_009913680.1.83932 WP_009913680.1.8418 WP_009913680.1.84265 WP_009913680.1.84320 WP_009913680.1.84781 WP_009913680.1.84833 WP_009913680.1.84980 WP_009913680.1.85203 WP_009913680.1.8593 WP_009913680.1.86253 WP_009913680.1.86308 WP_009913680.1.86484 WP_009913680.1.86597 WP_009913680.1.87536 WP_009913680.1.87701 WP_009913680.1.8782 WP_009913680.1.87920 WP_009913680.1.88112 WP_009913680.1.88485 WP_009913680.1.88589 WP_009913680.1.8884 WP_009913680.1.89386 WP_009913680.1.89809 WP_009913680.1.8988 WP_009913680.1.90086 WP_009913680.1.90201 WP_009913680.1.90829 WP_009913680.1.91514 WP_009913680.1.91556 WP_009913680.1.91765 WP_009913680.1.92132 WP_009913680.1.92148 WP_009913680.1.92409 WP_009913680.1.93556 WP_009913680.1.93920 WP_009913680.1.94032 WP_009913680.1.94758 WP_009913680.1.95162 WP_009913680.1.95945 WP_009913680.1.96033 WP_009913680.1.96140 WP_009913680.1.96874 WP_009913680.1.96940 WP_009913680.1.97199 WP_009913680.1.97390 WP_009913680.1.97820 WP_009913680.1.98193 WP_009913680.1.98331 WP_009913680.1.98866 WP_009913680.1.9894 WP_009913680.1.99026 WP_009913680.1.9916 WP_009913680.1.99357 WP_009913680.1.99512 WP_009913680.1.99520 WP_009913680.1.99785 WP_009913680.1.99786 WP_009913680.1.99974 gi|16804298|ref|NP_465783.1| gi|405759310|ref|YP_006688586.1| gi|470211303|ref|YP_007607877.1| 169963.lmo2259 gi|386051235|ref|YP_005969226.1| gi|470208167|ref|YP_007604742.1| gi|404414342|ref|YP_006699929.1| gi|404284756|ref|YP_006685653.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]